KEGG   Homo sapiens (human): 5050Help
Entry
5050              CDS       T01001                                 

Gene name
PAFAH1B3, PAFAHG
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b catalytic subunit 3
  KO
K16795  platelet-activating factor acetylhydrolase IB subunit beta/gamma [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5050 (PAFAH1B3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     5050 (PAFAH1B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Lipase_GDSL_3
Motif
Other DBs
NCBI-GeneID: 5050
NCBI-ProteinID: NP_001139411
OMIM: 603074
HGNC: 8576
Ensembl: ENSG00000079462
Vega: OTTHUMG00000182795
Pharos: Q15102(Tbio)
UniProt: Q15102 A0A024R0L6
Position
19q13.2
AA seq 231 aa AA seqDB search
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRE
LFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI
VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVH
SDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaggagaacccagccagcaagcccacgccggtgcaggacgtacagggcgac
gggcgctggatgtccctgcaccatcggttcgtggctgacagcaaagataaggaacccgaa
gtcgtcttcatcggggactccttggtccagctcatgcaccagtgcgagatctggcgcgag
ctcttctctcctctgcatgcacttaactttggcattggtggtgacggcacacagcatgta
ctgtggcggctggagaatggggagctggaacacatccggcccaagattgtggtggtctgg
gtgggcaccaacaaccacggacacacagcagagcaggtgactggtggcatcaaggccatt
gtgcaactggtgaatgagcgacagccccaggcccgggttgtggtgctgggcctgcttccg
cgaggccaacatcccaacccacttcgggagaagaaccgacaggtgaacgagctggtacgg
gcggcactggctggccaccctcgggcccacttcctagatgccgaccctggctttgtgcac
tcagatggcaccatcagccatcatgacatgtatgattacctgcatctgagccgcctgggc
tacacacctgtttgccgggctctgcactccctgcttctgcgtctgctggcccaagaccag
ggccaaggtgctcccctgctggagcccgcaccctaa

DBGET integrated database retrieval system