KEGG   Homo sapiens (human): 50506Help
Entry
50506             CDS       T01001                                 

Gene name
DUOX2, LNOX2, NOXEF2, P138-TOX, TDH6, THOX2
Definition
(RefSeq) dual oxidase 2
  KO
K13411  dual oxidase [EC:1.6.3.1 1.11.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
Disease
H00251  Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    50506 (DUOX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50506 (DUOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.1  NAD(P)H oxidase (H2O2-forming)
     50506 (DUOX2)
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     50506 (DUOX2)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    50506 (DUOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase NAD_binding_6 Ferric_reduct FAD_binding_8 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 50506
NCBI-ProteinID: NP_054799
OMIM: 606759
HGNC: 13273
Ensembl: ENSG00000140279
Vega: OTTHUMG00000131355
Pharos: Q9NRD8(Tbio)
UniProt: Q9NRD8
Position
15q21.1
AA seq 1548 aa AA seqDB search
MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRR
VPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVE
TPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLD
GSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYE
WLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKG
FQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLS
QLELLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTL
RDVLVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAI
TIIALCCLPLVSLLLSGVVAYFRGREHKKLQKKLKESVKKEAAKDGVPAMEWPGPKERSS
PIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNNRGCRTLLLKIPKEYDLVLLF
SSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVL
DINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQL
AEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNI
SCRVSFITRTPGERSHPQGLGPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQ
RGFLAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGI
ILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAIL
HSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLA
IMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTL
TSAPHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVS
VLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEEND
HQDLVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFN
SLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF
NT seq 4647 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtgcaagaccagaggcactgatgctcctgggagctcttctgactggatccctg
ggtccatcgggcaatcaggacgcactctcactgccctgggaagtgcagcgctatgacggc
tggtttaacaacctgaggcaccacgagcgtggtgctgttggctgccggttgcagcgccgc
gtaccagccaattacgccgacggtgtgtatcaggctctggaggagccgcagctgcccaac
ccgcgccggctcagcaacgcagccacgcggggcatagccggcctgccgtcgctccacaac
cgcaccgtactgggggtcttctttggctaccatgttctttccgacgtggtgagcgtggaa
acgcccggttgccccgccgagttcctcaacatccgcatcccacctggagaccccgtgttc
gaccccgaccagcgcggggacgtggtgctgcccttccagaggagccgctgggaccccgag
accggacggagtcccagcaacccccgggacctggccaaccaggtgacgggctggctggac
ggcagcgccatctatggctcctcgcactcctggagcgacgcgctgcggagcttctcgggg
ggacagctggcgtcggggcccgaccccgctttcccccgagactcgcagaaccccctgctc
atgtgggcggcgcccgaccccgccaccgggcagaacgggccccgggggctgtacgccttc
ggggcagagagagggaaccgggaacccttcctgcaggcgctgggcctgctctggttccgc
taccacaacctgtgggcgcagaggctggcccgccagcacccagactgggaggacgaggag
ctgttccagcacgcacgcaagagggtcatcgccacctaccagaacatcgctgtgtatgag
tggctgcccagcttcctgcagaaaacactcccggagtatacaggataccgtcctttccta
gaccccagcatctccccggaatttgtggtggcctctgagcagttcttctctaccatggtg
ccccctggtgtctacatgagaaatgccagctgtcatttccggaaggtcctgaacaagggt
tttcaaagctcccaagctctcagggtctgcaacaactactggattcgggagaaccccaat
ctgaacagtacccaggaggtgaatgagctgctgctgggaatggcctcccagatttcggag
ttggaggacaacatagtggttgaagatctgagggattactggcctggccctggcaaattc
tcccgtacagactatgtggccagcagcatccaacgtggccgagatatggggctgcccagc
tatagccaggccctgctggcctttgggctggacatcccaaggaactggagtgatctcaac
cctaatgtggacccccaggtgctggaggccacagctgccctgtacaaccaggacctatcc
cagctagagctgctccttggggggctcctggagagccatggggaccctggacccctgttc
agtgccattgtcctcgaccagtttgtacggctgcgggatggtgaccgctactggtttgag
aacaccaggaatgggctgttctccaagaaggagattgaagacatccgaaataccaccctg
cgggacgtgctggtcgctgttatcaacattgaccccagtgccctgcagcccaatgtcttt
gtctggcataaaggtgcaccctgccctcaacctaagcagctcacaactgacggcctgccc
cagtgtgcacccctgactgtgcttgacttctttgaaggcagcagccctggttttgccatc
accatcattgctctctgctgccttcccttagtgagtctgcttctctctggagtggtggcc
tatttccggggccgagaacacaagaagctacaaaagaaactcaaagagagcgtgaagaag
gaagcagccaaagatggagtgccagcgatggagtggccaggccccaaggagaggagcagt
cccatcatcatccagctgctgtcagacaggtgtctgcaggtcctgaacaggcatctcact
gtgctccgtgtggtccagctgcagcctctgcagcaggtcaacctcatcctgtccaacaac
cgaggatgccgcaccctgctgctcaagatccctaaggagtatgacctggtgctgctgttt
agttctgaagaggaacggggcgcctttgtgcagcagctatgggacttctgcgtgcgctgg
gctctgggcctccatgtggctgagatgagcgagaaggagctatttaggaaggctgtgaca
aagcagcagcgggaacgcatcctggagatcttcttcagacacctttttgctcaggtgctg
gacatcaaccaggccgacgcagggaccctgcccctggactcctcccagaaggtgcgggag
gccctgacctgcgagctgagcagggccgagtttgccgagtccctgggcctcaagccccag
gacatgtttgtggagtccatgttctctctggctgacaaggatggcaatggctacctgtcc
ttccgagagttcctggacatcctggtggtcttcatgaaaggctccccagaggataagtcc
cgtctaatgtttaccatgtatgacctggatgagaatggcttcctctccaaggacgaattc
ttcaccatgatgcgatccttcatcgagatctccaacaactgcctgtccaaggcccagctg
gccgaggtggtggagtctatgttccgggagtcgggattccaggacaaggaggagctgaca
tgggaggattttcacttcatgctgcgggaccatgacagcgagctccgcttcacgcagctc
tgtgtcaaaggtggaggtggaggtggaaatggtattagagatatctttaaacaaaacatc
agctgtcgagtctcgttcatcactcggacacctggggagcgctcccacccccagggactg
gggccccctgccccagaagccccagagctgggaggccctggactgaagaagaggtttggc
aaaaaggcagcagtgcccactccccggctgtacacagaggcgctgcaagagaagatgcag
cgaggcttcctagcccaaaagctgcagcagtacaagcgcttcgtggagaactaccggagg
cacatcgtgtgtgtggcaatcttctcggccatctgtgttggcgtgtttgcagatcgtgct
tactactatggctttgcctcgccaccctcggacattgcacagaccaccctcgtgggcatc
atcctgtcacgaggcacggcggccagcgtctccttcatgttctcttatatcttgctcacc
atgtgccgcaacctcataaccttcctgcgagagactttcctcaaccgctatgtgcctttt
gatgccgcagtggacttccaccgctggatcgccatggctgctgttgtcctggccattttg
cacagtgctggccacgcagtcaatgtctacatcttctcagtcagcccactcagcctgctg
gcctgcatattccccaacgtctttgtgaatgatgggtccaagcttccccagaagttctat
tggtggttcttccagaccgtcccaggtatgacaggtgtgcttctgctcctggtcctggcc
atcatgtatgtcttcgcctcccaccacttccgccgccgcagcttccggggcttctggctg
acccaccacctctacatcctgctctatgccctgctcatcatccatggcagctatgctctg
atccagctgcccactttccacatctacttcctggtcccggcaatcatctatggaggtgac
aagctggtgagcctgagccggaagaaggtggagatcagcgtggtgaaggcggagctgctg
ccctcaggagtgacctacctgcaattccagaggccccaaggctttgagtacaagtcagga
cagtgggtgcggatcgcctgcctggctctggggaccaccgagtaccaccccttcacactg
acctccgcgccccatgaggacacactcagcctgcacatccgggcagtggggccctggacc
actcgcctcagggagatctactcatccccaaagggcaatggctgtgctggatacccaaag
ctgtaccttgatggaccgtttggagagggccatcaggagtggcataaatttgaggtgtca
gtgttggtgggagggggcattggggtcaccccctttgcctccatcctcaaagacctggtc
ttcaagtcatccttgggcagccaaatgctgtgtaagaagatctacttcatctgggtgaca
cggacccagcgtcagtttgagtggctggctgacatcatccaagaggtggaggagaacgac
caccaggacctggtgtctgtgcacatttatgtcacccagctggctgagaagttcgacctc
aggaccaccatgctatacatctgcgagcggcacttccagaaagtgctgaaccggagtctg
ttcacgggcctgcgctccatcacccactttggccgtccccccttcgagcccttcttcaac
tccctgcaggaggtccacccacaggtgcgcaagatcggggtgttcagctgcggccctcca
ggaatgaccaagaatgtagagaaggcctgtcagctcgtcaacaggcaggaccgagcccac
ttcatgcaccactatgagaacttctga

DBGET integrated database retrieval system