KEGG   Homo sapiens (human): 50508Help
Entry
50508             CDS       T01001                                 

Gene name
NOX3, GP91-3, MOX-2
Definition
(RefSeq) NADPH oxidase 3
  KO
K21422  NADPH oxidase 3 [EC:1.6.3.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     50508 (NOX3)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    50508 (NOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 50508
NCBI-ProteinID: NP_056533
OMIM: 607105
HGNC: 7890
Ensembl: ENSG00000074771
Vega: OTTHUMG00000015883
Pharos: Q9HBY0(Tbio)
UniProt: Q9HBY0
Position
6q25.3
AA seq 568 aa AA seqDB search
MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
SRTLQKMCHLYSSADPRGVHFYYNKESF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatggggtgctggattttgaatgagggtctctccaccatattagtactctcatggctg
ggaataaatttttatctgtttattgacacgttctactggtatgaagaggaggagtctttc
cattacacacgagttattttgggttcaacactggcttgggcacgagcatccgcactgtgc
ctgaattttaactgcatgctaattctaatacctgtcagtcgaaaccttatttcattcata
agaggaacaagtatttgctgcagaggaccgtggaggaggcaattagacaaaaacctcaga
tttcacaaactggtcgcctatgggatagctgttaatgcaaccatccacatcgtggcgcat
ttcttcaacctggaacgctaccactggagccagtccgaggaggcccagggacttctggcc
gcactttccaagctgggcaacacccctaacgagagctacctcaaccctgtccggaccttc
cccacaaacacaaccactgaattgctaaggacaatagcaggcgtcaccggtctggtgatc
tctctggctttagtcttgatcatgacctcgtcaactgagttcatcagacaggcctcctat
gagttgttctggtacacacaccatgttttcatcgtcttctttctcagcctggccatccat
gggacgggtcggattgttcgaggccaaacccaagacagtctctctctgcacaacatcacc
ttctgtagagaccgctatgcagaatggcagacagtggcccaatgccccgtgcctcaattt
tctggcaaggaaccctcggcttggaaatggattttaggccctgtggtcttgtatgcatgt
gaaagaataattaggttctggcgatttcaacaagaagttgtcattaccaaggtggtaagc
cacccctctggagtcctggaacttcacatgaaaaagcgtggctttaaaatggcgccaggg
cagtacatcttggtgcagtgcccagccatatcttcgctggagtggcaccccttcaccctt
acctctgccccccaggaggactttttcagcgtgcacatccgggcagcaggagactggaca
gcagcgctactggaggcctttggggcagagggacaggccctccaggagccctggagcctg
ccaaggctggcagtggacgggccctttggaactgccctgacagatgtatttcactaccca
gtgtgtgtgtgcgttgccgcggggatcggagtcactcccttcgctgctcttctgaaatct
atatggtacaaatgcagtgaggcacagaccccactgaagctgagcaaggtgtatttctac
tggatttgccgggatgcaagagcttttgagtggtttgctgatctcttactctccctggaa
acacggatgagtgagcaggggaaaactcactttctgagttatcatatatttcttaccggc
tgggatgaaaatcaggctcttcacatagctttacactgggacgaaaatactgacgtgatt
acaggcttaaagcagaagaccttctatgggaggcccaactggaacaatgagttcaagcag
attgcctacaatcaccccagcagcagtattggcgtgttcttctgtggacctaaagctctc
tcgaggacacttcaaaagatgtgccacttgtattcatcagctgaccccagaggtgttcat
ttctattacaacaaggagagcttctag

DBGET integrated database retrieval system