KEGG   Homo sapiens (human): 5052
Entry
5052              CDS       T01001                                 

Gene name
PRDX1, MSP23, NKEF-A, NKEFA, PAG, PAGA, PAGB, PRX1, PRXI, TDPX2
Definition
(RefSeq) peroxiredoxin 1
  KO
K13279  peroxiredoxin 1 [EC:1.11.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
hsa05146  Amoebiasis
Disease
H02221  Methylmalonic aciduria and homocystinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5052 (PRDX1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5052 (PRDX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5052 (PRDX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     5052 (PRDX1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5052 (PRDX1)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC Endothelin
Other DBs
NCBI-GeneID: 5052
NCBI-ProteinID: NP_001189360
OMIM: 176763
HGNC: 9352
Ensembl: ENSG00000117450
Vega: OTTHUMG00000007738
Pharos: Q06830(Tbio)
UniProt: Q06830 A0A384NPQ2
Structure
PDB: 
4XCS 3HY2 2RII

Position
1p34.1
AA seq 199 aa
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcttcaggaaatgctaaaattgggcaccctgcccccaacttcaaagccacagctgtt
atgccagatggtcagtttaaagatatcagcctgtctgactacaaaggaaaatatgttgtg
ttcttcttttaccctcttgacttcacctttgtgtgccccacggagatcattgctttcagt
gatagggcagaagaatttaagaaactcaactgccaagtgattggtgcttctgtggattct
cacttctgtcatctagcatgggtcaatacacctaagaaacaaggaggactgggacccatg
aacattcctttggtatcagacccgaagcgcaccattgctcaggattatggggtcttaaag
gctgatgaaggcatctcgttcaggggcctttttatcattgatgataagggtattcttcgg
cagatcactgtaaatgacctccctgttggccgctctgtggatgagactttgagactagtt
caggccttccagttcactgacaaacatggggaagtgtgcccagctggctggaaacctggc
agtgataccatcaagcctgatgtccaaaagagcaaagaatatttctccaagcagaagtga

DBGET integrated database retrieval system