KEGG   Homo sapiens (human): 5055Help
Entry
5055              CDS       T01001                                 

Gene name
SERPINB2, HsT1201, PAI, PAI-2, PAI2, PLANH2
Definition
(RefSeq) serpin family B member 2
  KO
K19821  plasminogen activator inhibitor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5055 (SERPINB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5055 (SERPINB2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5055 (SERPINB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin GDE_C FAD_SOX
Motif
Other DBs
NCBI-GeneID: 5055
NCBI-ProteinID: NP_001137290
OMIM: 173390
HGNC: 8584
Ensembl: ENSG00000197632
Vega: OTTHUMG00000060592
Pharos: P05120(Tbio)
UniProt: P05120
Structure
PDB: 

Position
18q21.33-q22.1
AA seq 415 aa AA seqDB search
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQF
NEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGN
YLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGK
IPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK
LNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMV
DVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctttgtgtggcaaacacactctttgccctcaatttattcaagcatctggca
aaagcaagccccacccagaacctcttcctctccccatggagcatctcgtccaccatggcc
atggtctacatgggctccaggggcagcaccgaagaccagatggccaaggtgcttcagttt
aatgaagtgggagccaatgcagttacccccatgactccagagaactttaccagctgtggg
ttcatgcagcagatccagaagggtagttatcctgatgcgattttgcaggcacaagctgca
gataaaatccattcatccttccgctctctcagctctgcaatcaatgcatccacagggaat
tatttactggaaagtgtcaataagctgtttggtgagaagtctgcgagcttccgggaagaa
tatattcgactctgtcagaaatattactcctcagaaccccaggcagtagacttcctagaa
tgtgcagaagaagctagaaaaaagattaattcctgggtcaagactcaaaccaaaggcaaa
atcccaaacttgttacctgaaggttctgtagatggggataccaggatggtcctggtgaat
gctgtctacttcaaaggaaagtggaaaactccatttgagaagaaactaaatgggctttat
cctttccgtgtaaactcggctcagcgcacacctgtacagatgatgtacttgcgtgaaaag
ctaaacattggatacatagaagacctaaaggctcagattctagaactcccatatgctgga
gatgttagcatgttcttgttgcttccagatgaaattgccgatgtgtccactggcttggag
ctgctggaaagtgaaataacctatgacaaactcaacaagtggaccagcaaagacaaaatg
gctgaagatgaagttgaggtatacataccccagttcaaattagaagagcattatgaactc
agatccattctgagaagcatgggcatggaggacgccttcaacaagggacgggccaatttc
tcagggatgtcggagaggaatgacctgtttctttctgaagtgttccaccaagccatggtg
gatgtgaatgaggagggcactgaagcagccgctggcacaggaggtgttatgacagggaga
actggacatggaggcccacagtttgtggcagatcatccttttctttttcttattatgcat
aagataaccaactgcattttatttttcggcagattttcctcaccctaa

DBGET integrated database retrieval system