KEGG   Homo sapiens (human): 5058Help
Entry
5058              CDS       T01001                                 

Gene name
PAK1, PAKalpha
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04360  Axon guidance
hsa04392  Hippo signaling pathway - multiple species
hsa04510  Focal adhesion
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
Network
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5058 (PAK1)
   04010 MAPK signaling pathway
    5058 (PAK1)
   04012 ErbB signaling pathway
    5058 (PAK1)
   04392 Hippo signaling pathway - multiple species
    5058 (PAK1)
   04024 cAMP signaling pathway
    5058 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5058 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5058 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5058 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    5058 (PAK1)
   04660 T cell receptor signaling pathway
    5058 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    5058 (PAK1)
   04062 Chemokine signaling pathway
    5058 (PAK1)
  09158 Development
   04360 Axon guidance
    5058 (PAK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    5058 (PAK1)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    5058 (PAK1)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5058 (PAK1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5058 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5058 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5058 (PAK1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5058 (PAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5058 (PAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5058 (PAK1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    5058 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    5058 (PAK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     5058 (PAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like APH DSHCT Kdo
Motif
Other DBs
NCBI-GeneID: 5058
NCBI-ProteinID: NP_002567
OMIM: 602590
HGNC: 8590
Ensembl: ENSG00000149269
Vega: OTTHUMG00000165138
Pharos: Q13153(Tchem)
UniProt: Q13153 A0A024R5P0
Structure
PDB: 

Position
11q13.5-q14.1
AA seq 545 aa AA seqDB search
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccattttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcgaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattacaattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacacagcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctg
tgggttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacttgc
atggatgaaggccaaattgcagctgtgtgccgtgagtgtctgcaggctctggagttcttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcaattc
ctgaagattgccaagcccctctccagcctcactccactgattgctgcagctaaggaggca
acaaagaacaatcactaa

DBGET integrated database retrieval system