KEGG   Homo sapiens (human): 50615Help
Entry
50615             CDS       T01001                                 

Gene name
IL21R, CD360, IMD56, NILR
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease (IBD)
Drug target
Denenicokin: D09332
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    50615 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50615 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50615 (IL21R)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    50615 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    50615 (IL21R)
   04090 CD Molecules [BR:hsa04090]
    50615 (IL21R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   50615 (IL21R)
CD molecules [BR:hsa04090]
 Proteins
  50615 (IL21R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 50615
NCBI-ProteinID: NP_068570
OMIM: 605383
HGNC: 6006
Ensembl: ENSG00000103522
Vega: OTTHUMG00000131675
Pharos: Q9HBE5(Tbio)
UniProt: Q9HBE5
Structure
PDB: 

Position
16p12.1
AA seq 538 aa AA seqDB search
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggaaatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcatgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgaatggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccatccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcatgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctccagc
ctggagctgggaccctggagcccagaggtgccctccaccctggaggtgtacagctgccac
ccaccacggagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgacggtgtgcccaagcccagcttctggccgacagcccagaactcggggggc
tcagcttacagtgaggagagggatcggccatacggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggatgctggcctggagcccagcccaggcctagaggacccactcttggat
gcagggaccacagtcctgtcctgtggctgtgtctcagctggcagccctgggctaggaggg
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggtctcagagagtgaggcgggctca
cccctggccggcctggatatggacacgtttgacagtggctttgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggacgaaggacccccccggagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctaa

DBGET integrated database retrieval system