KEGG   Homo sapiens (human): 50617Help
Entry
50617             CDS       T01001                                 

Gene name
ATP6V0A4, A4, ATP6N1B, ATP6N2, RDRTA2, RTA1C, RTADR, STV1, VPH1, VPP2
Definition
(RefSeq) ATPase H+ transporting V0 subunit a4
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H00428  Distal renal tubular acidosis (RTA type 1)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    50617 (ATP6V0A4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50617 (ATP6V0A4)
   04142 Lysosome
    50617 (ATP6V0A4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    50617 (ATP6V0A4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    50617 (ATP6V0A4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    50617 (ATP6V0A4)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    50617 (ATP6V0A4)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50617 (ATP6V0A4)
   05152 Tuberculosis
    50617 (ATP6V0A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    50617 (ATP6V0A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    50617 (ATP6V0A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50617 (ATP6V0A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V_ATPase_I Bacillus_HBL
Motif
Other DBs
NCBI-GeneID: 50617
NCBI-ProteinID: NP_065683
OMIM: 605239
HGNC: 866
Ensembl: ENSG00000105929
Vega: OTTHUMG00000157122
Pharos: Q9HBG4(Tbio)
UniProt: Q9HBG4 A0A024R791
Position
7q34
AA seq 840 aa AA seqDB search
MVSVFRSEEMCLSQLFLQVEAAYCCVAELGELGLVQFKDLNMNVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIVVQLLEKSPLTPLPREMITLETVLEKLEGELQEANQNQQALKQS
FLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKLGFIAGVINRE
RMASFERLLWRICRGNVYLKFSEMDAPLEDPVTKEEIQKNIFIIFYQGEQLRQKIKKICD
GFRATVYPCPEPAVERREMLESVNVRLEDLITVITQTESHRQRLLQEAAANWHSWLIKVQ
KMKAVYHILNMCNIDVTQQCVIAEIWFPVADATRIKRALEQGMELSGSSMAPIMTTVQSK
TAPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGTVMLL
AALWMILNERRLLSQKTDNEIWNTFFHGRYLILLMGIFSIYTGLIYNDCFSKSLNIFGSS
WSVQPMFRNGTWNTHVMEESLYLQLDPAIPGVYFGNPYPFGIDPIWNLASNKLTFLNSYK
MKMSVILGIVQMVFGVILSLFNHIYFRRTLNIILQFIPEMIFILCLFGYLVFMIIFKWCC
FDVHVSQHAPSILIHFINMFLFNYSDSSNAPLYKHQQEVQSFFVVMALISVPWMLLIKPF
ILRASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVF
VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMNSGLQTRGWGGIVGVFI
IFAVFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYVGDGYKFSPFSFKHILDGTAEE
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgtgtttcgaagcgaggagatgtgtttgtcacaactgtttctccaggtggaa
gctgcatattgctgtgtggctgagctcggagagctcggattggttcagttcaaagattta
aatatgaatgtgaacagctttcaaaggaaatttgtgaatgaagtcagaaggtgtgaatca
ctggagagaatcctccgttttctggaagacgagatgcaaaatgagattgtagttcagttg
ctcgagaaaagcccactgaccccgctcccacgggaaatgattaccctggagactgttcta
gaaaaactggaaggagagttacaggaagccaaccagaaccagcaggccttgaaacaaagc
ttcctagaactgacagaactgaaatacctcctgaagaaaacccaagacttctttgagacg
gaaaccaatttagctgatgatttctttactgaggacacttctggcctcctggagttgaaa
gcagtgcctgcatatatgaccggaaagttggggttcatagccggtgtgatcaacagggag
aggatggcttcctttgagcggttactgtggcgaatctgccgaggaaacgtgtacttgaag
ttcagtgagatggacgcccctctggaggatcctgtgacgaaagaagaaattcagaagaac
atattcatcatattttaccaaggagagcagctcaggcagaaaatcaagaagatctgtgat
gggtttcgagccactgtctacccttgcccagagcctgcggtggagcgcagagagatgttg
gagagcgtcaatgtgaggctggaagatttaatcaccgtcataacacaaacagagtctcac
cgccagcgcctgctgcaggaagccgctgccaactggcactcctggctcatcaaggtgcag
aagatgaaagctgtctaccacatcctgaacatgtgcaacatcgacgtcacccagcagtgt
gtcatcgccgagatctggttcccggtggcagatgccacacgtatcaagagggcactggag
caaggcatggaactaagtggctcctccatggcccccatcatgaccacagtgcaatctaaa
acagcccctcccacatttaacaggaccaataaattcacagctggcttccagaatattgtt
gatgcctatggtgtcggcagctaccgggagataaacccagccccctacaccatcatcact
ttccccttcctgttcgctgtgatgtttggagactgtggtcatggaaccgtgatgctcctg
gctgcactttggatgattctgaatgagagacgcttgctctcccagaagacagacaatgag
atttggaacaccttcttccacgggcgctatctgatcctacttatgggcatcttctccatc
tacacgggtttgatctacaatgactgcttctccaagtccttgaacatctttggctcttct
tggagtgtccaacccatgttcagaaacggcacatggaatactcatgtaatggaggaaagt
ctatatctgcagctggacccagccataccaggagtgtattttggaaatccatacccgttt
gggattgatccgatttggaacttggcttcaaacaaactcacatttctgaactcgtataaa
atgaagatgtcggtgatcctgggaattgtccagatggttttcggtgtcatcctcagcctt
ttcaatcacatatacttcagaagaactctcaacatcattctgcaatttatccctgagatg
atttttatcctgtgtctgtttggatacctggttttcatgatcattttcaaatggtgctgc
tttgacgtccatgtatctcagcacgcccccagcatcctcatccacttcatcaacatgttt
ctgtttaactacagtgactcttccaacgcacccctctacaaacatcagcaagaagtccaa
agtttctttgtggttatggctttgatttctgtgccgtggatgcttctgattaagccgttt
attcttagagccagtcatcggaaatcccagctgcaggcatccaggatccaagaagatgcc
actgagaacattgaaggtgatagctccagcccttctagccgttctggccagaggacttct
gcagatacccacggggctctggacgaccatggagaagagttcaactttggagacgtcttt
gtccaccaagccatccacaccatcgagtactgcctgggctgcatttcaaacacagcctcc
tacctgcggctctgggccctcagcctggctcatgcacaactgtctgaagtgctctggact
atggtgatgaacagcggccttcagacgcgaggctggggaggaatcgtcggggtttttatt
atttttgccgtatttgctgtcctgacagtagccatccttctgatcatggagggcctctct
gctttcctgcacgccctgcgactgcactgggttgagttccagaacaagttctatgtcggg
gatggttacaagttttctccattctcctttaaacacatcctggatggcacagccgaggag
tag

DBGET integrated database retrieval system