KEGG   Homo sapiens (human): 5062Help
Entry
5062              CDS       T01001                                 

Gene name
PAK2, PAK65, PAKgamma
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5062 (PAK2)
   04010 MAPK signaling pathway
    5062 (PAK2)
   04012 ErbB signaling pathway
    5062 (PAK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5062 (PAK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5062 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5062 (PAK2)
  Development
   04360 Axon guidance
    5062 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5062 (PAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5062 (PAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5062 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 5062
NCBI-ProteinID: NP_002568
OMIM: 605022
HGNC: 8591
Ensembl: ENSG00000180370
Vega: OTTHUMG00000155534
Pharos: Q13177(Tchem)
UniProt: Q13177 A8K5M4
Position
3q29
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagataagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaagagaaaaagcccaggcataaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacccgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcatacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcacatgttgatggtgctgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactatcgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcactgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaactgatcattaacgagattctggtgatgaaagaa
ttgaaaaatcccaacatcgttaactttttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggggggtcactcactgatgtggtaacagaaacgtgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tctgttaagctcactgactttggtttctgtgcccagatcacccctgagcagagcaaacgc
agtaccatggtcggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccgttatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

DBGET integrated database retrieval system