KEGG   Homo sapiens (human): 5063Help
Entry
5063              CDS       T01001                                 

Gene name
PAK3, ARA, MRX30, MRX47, OPHN3, PAK-3, PAK3beta, bPAK, beta-PAK
Definition
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05211  Renal cell carcinoma
Disease
H00480  Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5063 (PAK3)
   04012 ErbB signaling pathway
    5063 (PAK3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5063 (PAK3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5063 (PAK3)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5063 (PAK3)
  Development
   04360 Axon guidance
    5063 (PAK3)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5063 (PAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5063 (PAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5063 (PAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Spt5_N APH DSHCT Kdo Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 5063
NCBI-ProteinID: NP_001121645
OMIM: 300142
HGNC: 8592
Ensembl: ENSG00000077264
Vega: OTTHUMG00000022202
Pharos: O75914(Tchem)
UniProt: O75914
Structure
PDB: 

Position
Xq23
AA seq 559 aa AA seqDB search
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccggctcctccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattccagagcaatgggcacgattactccaaacttcc
aacataacaaaattggaacagaagaagaacccacaagctgttctagatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agtgcacatggatacatagcagcccatccttcgagtacaaaaacagcatctgagcctcca
ttggcccctcctgtgtctgaagaagaagatgaagaggaagaagaagaagaagatgaaaat
gagccaccaccagttatcgcaccaagaccagagcatacaaaatcaatctatactcgttct
gtggttgaatccattgcttcaccagcagtaccaaataaagaggtcacaccaccctctgct
gaaaatgccaattccagtactttgtacaggaacacagatcggcaaagaaaaaaatccaag
atgacagatgaggagatcttagagaagctaagaagcattgtgagtgttggggacccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggtactgtttatacagca
ctagacattgcaacaggacaagaggtggccataaagcagatgaaccttcaacagcaaccc
aagaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccctaatatt
gttaattatttagatagctacttggtgggtgatgaactatgggtagtcatggaatacttg
gctggtggctctctgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctgcaagctttggatttcctgcactcaaaccaggtgatccat
agagatataaagagtgacaatattcttctcgggatggatggctctgttaaattgactgac
tttgggttctgtgcccagatcactcctgagcaaagtaaacgaagcactatggtgggaacc
ccatattggatggcacctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctcttggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattgtatctgatagccactaatggaactccagagctccagaatcct
gagagactgtcagctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcaattaagaacagcagccgctaa

DBGET integrated database retrieval system