KEGG   Homo sapiens (human): 50649Help
Entry
50649             CDS       T01001                                 

Gene name
ARHGEF4, ASEF, ASEF1, GEF4, STM6
Definition
(RefSeq) Rho guanine nucleotide exchange factor 4
  KO
K05769  Rho guanine nucleotide exchange factor 4/29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    50649 (ARHGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50649 (ARHGEF4)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    50649 (ARHGEF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 PH SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 50649
NCBI-ProteinID: NP_056135
OMIM: 605216
HGNC: 684
Ensembl: ENSG00000136002
Vega: OTTHUMG00000131657
Pharos: Q9NR80(Tbio)
UniProt: Q9NR80 Q9NTG0
Structure
PDB: 

Position
2q21.1
AA seq 690 aa AA seqDB search
MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPH
RSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSH
PLSQSAPTGLNHMGWPEHTPGTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGG
GGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGE
GWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYI
KHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSE
LGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQ
WQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDV
LYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKA
FAREREQVQLDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNR
PQQQVLVLAEPRRKPSTFWHSISRLAPFRK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggaagaaccagcaggtgagaagcccagttgctctcacagtcagaaggcgttc
cacatggagcctgcccagaagccctgcttcaccactgacatggtgacatgggccctcctc
tgcatctctgcagagactgtgcgtggggaggctccttcacagcctaggggcatccctcac
cgctcgcccgtcagtgtggatgacctgtggctggagaagacacagagaaagaagttgcag
aagcaggcccacgtcgaaaggaggctgcacataggggcagtgcacaaagatggagtcaag
tgctggagaaagacgatcattacctctccagagtctttgaatctccctagaagaagccat
ccactctcccagagtgctccaacgggactgaaccacatgggctggccagagcacacacca
ggcactgccatgcctgatggagctctggacacagctgtctgcgctgacgaagtggggagc
gaggaggacctgtatgatgacctgcacagctccagccaccactacagccaccctggaggg
ggtggggagcagctggctatcaatgagctcatcagcgatggcagtgtggtctgcgctgaa
gcactctgggaccatgtcaccatggacgaccaggagctgggcttcaaagctggggacgtc
atcgaagtgatggatgccaccaacagagagtggtggtggggccgggtcgccgatggcgag
ggctggtttccagccagcttcgttcggctgagggtgaatcaggacgagcccgcggatgac
gacgcccctctggccgggaacagcggagcggaggacggcggggcggaggcgcagagcagc
aaggaccagatgcggaccaacgtcatcaacgagatcctcagcactgagcgggactacatc
aagcacctgcgcgacatctgcgagggctacgtccggcagtgccgcaagcgcgcagacatg
ttcagcgaggagcagctgcgtaccatcttcgggaacatcgaggacatctaccgctgccag
aaggccttcgtgaaggccctggagcagaggttcaaccgcgagcgcccacacctgagcgag
ctgggtgcctgcttcctggagcatcaagccgacttccagatctactcggagtactgcaat
aaccaccccaacgcctgcgtggagctctcccggctcaccaagctcagcaagtacgtgtac
ttcttcgaggcctgccggctgctgcagaagatgattgacatctccctggatggcttcctg
ctgactccggtgcagaagatctgcaagtaccctctgcagctggccgagctgctcaaatac
acgcacccccagcacagggacttcaaggatgttgaagccgccttgcatgccatgaagaac
gtggcccagctcatcaacgagcggaagcggagacttgagaacatcgacaagattgctcag
tggcagagctccatagaggactgggagggagaagatctcttggtcaggagctcagaactc
atctactcgggggagctgactcgagttacacagcctcaagccaaaagccagcagcgaatg
ttctttctctttgaccaccagctcatctactgtaagaaggacctgctccgccgcgacgtg
ttgtactacaagggccggctggacatggacggcctggaggtggtggacctggaggacggg
aaggacagagacctccatgtgagcatcaagaacgccttccggctgcaccgtggcgccaca
ggggacagccacctgctgtgcaccaggaagcccgagcagaagcagcgctggctcaaggcc
tttgccagggagagggagcaggtgcagctggaccaggagacaggcttctccatcactgaa
ctgcagaggaagcaggccatgctgaatgccagcaagcagcaggtcacagggaagcccaaa
gctgttggccggccctgctacctgacgcgccagaagcacccagccctgcccagcaaccgg
ccccagcagcaggtcctggtgctggcggagcccaggcgcaagccatctaccttctggcac
agcatcagccggctggcacccttccgcaagtga

DBGET integrated database retrieval system