KEGG   Homo sapiens (human): 50651
Entry
50651             CDS       T01001                                 
Symbol
SLC45A1, DNB5, IDDNPF, PAST-A
Name
(RefSeq) solute carrier family 45 member 1
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
hsa  Homo sapiens (human)
Disease
H02463  Syndromic intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    50651 (SLC45A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   50651 (SLC45A1)
SSDB
Motif
Pfam: MFS_1 MFS_2 MFS_1_like
Other DBs
NCBI-GeneID: 50651
NCBI-ProteinID: NP_001073866
OMIM: 605763
HGNC: 17939
Ensembl: ENSG00000162426
UniProt: Q9Y2W3
Position
1:8318114..8344165
AA seq 748 aa
MIPAASSTPPGDALFPSVAPQDFWRSQVTGYSGSVTRHLSHRANNFKRHPKRRKCIRPSP
PPPPNTPCPLELVDFGDLHPQRSFRELLFNGCILFGIEFSYAMETAYVTPVLLQMGLPDQ
LYSLVWFISPILGFLLQPLLGAWSDRCTSRFGRRRPFILVLAIGALLGLSLLLNGRDIGI
ALADVTGNHKWGLLLTVCGVVLMDFSADSADNPSHAYMMDVCSPADQDRGLNIHALLAGL
GGGFGYVVGGIHWDKTGFGRALGGQLRVIYLFTAVTLSVTTVLTLVSIPERPLRPPSEKR
AAMKSPSLPLPPSPPVLPEEGPGDSLPSHTATNFSSPISPPSPLTPKYGSFISRDSSLTG
ISEFASSFGTANIDSVLIDCFTGGHDSYLAIPGSVPRPPISVSFPRAPDGFYRQDRGLLE
GREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQ
QVANILLNGVKYESELTGSSERAEQPLSVGRLCSTICNMPKALRTLCVNHFLGWLSFEGM
LLFYTDFMGEVVFQGDPKAPHTSEAYQKYNSGVTMGCWGMCIYAFSAAFYSAILEKLEEF
LSVRTLYFIAYLAFGLGTGLATLSRNLYVVLSLCITYGILFSTLCTLPYSLLCDYYQSKK
FAGSSADGTRRGMGVDISLLSCQYFLAQILVSLVLGPLTSAVGSANGVMYFSSLVSFLGC
LYSSLFVIYEIPPSDAADEEHRPLLLNV
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgatccccgcagccagcagcaccccgccgggagatgccctcttccccagcgtggcccca
caggacttctggaggtcccaggtcacgggctactcggggtccgtgacacgacacctcagt
caccgggccaacaacttcaaacgacaccccaagaggaggaagtgcattcgtccctcccca
cccccgccccccaacaccccgtgcccgcttgagctggtggacttcggggacctgcacccc
cagaggtccttccgggagctgcttttcaacggctgcattctctttggcatcgagttcagc
tacgccatggagacggcgtacgtgaccccggtgctcctgcagatgggcctgcccgaccag
ctctacagcctggtgtggttcatcagccccatcctcggattcctactgcagcctctgttg
ggtgcttggagtgaccggtgtacctcaaggtttggaaggagacgccctttcattcttgtc
ctggctataggggcactgctgggcctctcgctcttgctgaatggccgggacattggcatc
gccctggctgacgtgaccgggaaccacaagtggggcctgctgctgaccgtgtgcggtgtg
gtgctgatggactttagcgccgactcggcggacaaccccagccacgcctacatgatggac
gtgtgcagccccgcagaccaggaccgaggcctgaacatccacgccctcctggcaggtctc
ggaggaggctttggatacgtggtcggcggaatccactgggataaaacgggcttcgggagg
gccctggggggacagctccgagtcatttacctcttcactgcggtcaccctgagcgtcacc
accgtcctgaccctggtcagcatccctgagaggccgctgcggccgccgagtgagaagcgg
gcagccatgaagagccccagcctcccgctgcccccgtccccacccgtcctgccagaggaa
ggccctggcgacagcctcccgtcgcacacggccaccaacttctccagccccatctcgccg
cccagccccctcacgcccaagtacggcagcttcatcagcagggacagctccctgacgggc
atcagcgagttcgcctcatcctttggcacggccaacatagacagcgtcctcattgactgc
ttcacgggcggccacgacagctacctggccatccctggcagcgtccccaggccgcccatc
agcgtcagcttcccccgggcccccgacggcttctaccgccaggaccgtggacttctggag
ggcagagagggtgccctgacctccggctgtgacggggacattctgagggtgggctccttg
gacacctctaagccgaggtcatcagggattctgaagagacctcagaccttggccatcccg
gacgcagccggaggagggggtcccgaaaccagcaggagaaggaatgtgaccttcagtcag
caggtggccaatatcctgctcaacggcgtgaagtatgagagcgagctgacgggctccagc
gagcgcgcggagcagcctctgtccgtggggcgcctctgctccaccatctgcaacatgccc
aaggcgctacgcaccctctgcgtcaaccacttcctggggtggctctcattcgaggggatg
ttgctcttctacacagacttcatgggcgaggtggtgtttcagggggaccccaaggccccg
cacacatcagaggcgtatcagaagtacaacagcggcgtgaccatgggctgctggggcatg
tgtatctacgccttcagtgctgccttctactcagctatcctggagaagctggaggagttc
ctcagcgtccgcaccctctacttcatcgcctatctcgccttcggcctggggaccgggctt
gccaccctctccaggaacctctacgtggtcctgtcgctctgcataacctacgggatttta
ttttccaccctgtgcaccttgccttactcgctgctctgcgattactatcagagtaagaag
tttgcagggtccagtgcggacggcacccggcggggcatgggcgtggacatctctctgctg
agctgccagtacttcctggctcagattctggtctccctggtcctggggcccctgacctcg
gccgtgggcagtgccaacggggtgatgtacttctccagcctcgtgtccttcctgggctgc
ctgtactcctccctgtttgtcatttatgaaattcctcccagcgacgctgcagacgaggag
caccggcccctcctgctgaacgtctga

DBGET integrated database retrieval system