KEGG   Homo sapiens (human): 5069Help
Entry
5069              CDS       T01001                                 

Gene name
PAPPA, ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1
Definition
(RefSeq) pappalysin 1
  KO
K07762  pappalysin-1 [EC:3.4.24.79]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5069 (PAPPA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.79  pappalysin-1
     5069 (PAPPA)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M43: cytophagalysin family
   5069 (PAPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Laminin_G_3 Peptidase_M43 DUF4215 Notch Reprolysin_3 Peptidase_M10 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 5069
NCBI-ProteinID: NP_002572
OMIM: 176385
HGNC: 8602
Ensembl: ENSG00000182752
Vega: OTTHUMG00000021045
Pharos: Q13219(Tbio)
UniProt: Q13219 Q7Z613 B4DTA8
Position
9q33.1
AA seq 1627 aa AA seqDB search
MRLWSWVLHLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPP
PPPPPGGAWEAVRVPRRRQQREARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFT
LQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRAR
QVTTINAHRSYLPGQWVYLAATYDGQFMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLML
GGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTALPQLLLQENWDNVKHAWSPM
KDGSSPKVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQPKVVRYRVVNL
YEDDHKNPTVTREQVDFQHHQLAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIG
DENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGVCDMDCNYERFNFDGGECCDPEITN
VTQTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMH
LGGIVLNPSFYGMPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLC
NDTNPAPKHKSCGDPGPGNDTCGFHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLD
LVYQGWQPSRKPAPVALAPQVLGHTTDSVTLEWFPPIDGHFFERELGSACHLCLEGRILV
QYASNASSPMPCSPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQG
CYLELEFLYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLAVSGKNISLGPQNVFCDVPLT
IRLWDVGEEVYGIQIYTLDEHLEIDAAMLTSTADTPLCLQCKPLKYKVVRDPPLQMDVAS
ILHLNRKFVDMDLNLGSVYQYWVITISGTEESEPSPAVTYIHGSGYCGDGIIQKDQGEQC
DDMNKINGDGCSLFCRQEVSFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFL
DQWASNASVSHQDQQCPGWVIIGQPAASQVCRTKVIDLSEGISQHAWYPCTISYPYSQLA
QTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCR
NNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSP
AEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQ
TGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQL
KGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPG
YHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRI
KCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGS
ECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEP
FMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKD
LRGYSHG
NT seq 4884 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctggagttgggtgctgcacctggggctgctgagcgccgcgctgggctgcggg
ctggccgagcgtccccgccgggcccggagagacccgcgggccggccgacccccgcgcccc
gccgccggcccggccacctgcgccacccgggcggcccgcggccgccgcgcctcgccgccg
ccgccgccgccgccgggcggtgcctgggaagccgtgcgcgtcccccggcggcggcagcag
cgggaggcgaggggcgccaccgaggagccgagcccgccgagccgggcgctctatttcagc
gggcgaggcgagcagctgcgcctccgggccgacctcgagctgccccgggacgcgttcacg
ctgcaagtgtggctgcgagcggaggggggccagaggtctccggcagtgatcacagggctg
tatgacaaatgttcttatatctcacgtgaccgaggatgggtcgtgggcattcacaccatc
agtgaccaagacaacaaagacccacgctactttttctccttgaagacagaccgagcccgg
caagtgaccaccatcaatgcccaccgcagctacctcccaggccagtgggtatacctagct
gccacctatgatgggcagttcatgaagctctatgtgaatggtgcccaggtggccacctct
ggggaacaagtgggtggcatattcagcccactgacccagaagtgcaaagtgctcatgtta
gggggcagtgccctgaatcacaactaccggggctacatcgagcacttcagtctgtggaag
gtggccaggactcagcgggagatactgtctgacatggaaacccatggcgcccacactgct
ctacctcagctcctcctccaggagaactgggacaatgtgaagcatgcctggtcccccatg
aaggatggcagcagccccaaagtggaattcagcaatgcccacggctttctgctggacacg
agtctggagcctcctctgtgcggacagacattgtgtgacaacacagaggtcattgccagc
tacaatcagctctcaagtttccgccagcccaaggtggtgcgctaccgcgtggtcaacctc
tatgaagatgatcataagaacccgacggtgacgcgcgagcaggtggacttccagcaccat
cagctggctgaggccttcaagcaatacaacatctcctgggagctggacgtgctggaggtg
agcaactcctcccttcgccgccgcctcatcctggccaactgtgacatcagcaagattggg
gatgagaactgtgaccccgagtgcaaccacacgctgacgggccacgacggcggggattgc
cgccacctgcgccaccctgccttcgtgaagaagcagcacaacggggtgtgtgacatggac
tgcaactatgaacggttcaactttgatggtggagagtgctgtgaccctgaaatcaccaat
gtcactcagacttgctttgaccccgactctccacacagagcctacttggatgttaatgag
ctgaagaacattcttaaattggatggatcaacacatctcaatattttctttgcaaaatcc
tcagaggaggagttggcaggagtagcaacttggccatgggacaaggaggccctgatgcac
ttaggtggcattgtcttgaacccatctttctatggcatgcctgggcacacccacaccatg
atccatgagattggtcacagcctgggcctctatcacgtcttccgaggcatctcagaaatc
cagtcctgcagtgacccctgcatggagacagagccctccttcgagactggagacctctgc
aatgataccaacccagcccctaaacacaagtcctgtggtgacccagggccaggaaatgac
acctgtggctttcatagcttcttcaacactccttacaacaacttcatgagctatgcagat
gacgactgtacggactccttcacgcccaatcaagtcgccagaatgcactgttacctggac
ctggtctaccagggctggcagccctccaggaaaccagcgcctgttgccctcgccccccaa
gttctgggccacacaacggactctgtgacactggagtggttcccacctatagatggccat
ttctttgaaagagaattgggatcagcatgtcatctttgcctggaagggagaatcctggtg
cagtatgcttccaacgcttcctccccaatgccctgcagcccatcaggacactggagccct
cgtgaagcagaaggtcatcctgatgttgaacagccctgtaagtccagtgtccgcacctgg
agcccaaattcagctgtcaacccacacacggttcctccagcctgccctgagcctcaaggc
tgctacctcgagctggagttcctctaccccttggtccctgagtctctgaccatttgggtg
acctttgtctccactgactgggactctagtggagctgtcaatgacatcaaactgttggct
gtcagtgggaagaacatctccctgggtcctcagaatgtcttctgtgatgtcccactgacc
atcagactctgggacgtgggcgaggaggtgtatggcatccaaatctacacgctggatgag
cacctggagatcgatgctgccatgttgacctccactgcagacaccccactctgtctacag
tgtaagcccctgaagtataaggtggtccgggaccctcctctccagatggatgtggcctcc
atcctacatctcaataggaaattcgtagacatggatctaaatcttggcagtgtgtaccag
tattgggtcataactatttcaggaactgaagagagtgagccatcacctgctgtcacatac
atccatggaagtgggtactgtggcgatggcattatacaaaaagaccaaggtgaacaatgc
gacgacatgaataagatcaatggtgatggctgctcccttttctgccgacaagaagtctcc
ttcaattgtattgatgaacccagccggtgctatttccatgatggtgatggggtatgtgag
gagtttgaacaaaaaaccagcattaaggactgtggtgtctacacgccccagggattcctg
gatcagtgggcatccaatgcttcagtatctcatcaagaccagcaatgcccaggctgggtc
atcatcggacagccagcagcatcccaggtgtgtcgaaccaaggtgatagatctcagtgaa
ggcatttcccagcatgcctggtacccttgcaccatcagctacccatattcccagctggct
cagaccactttttggctccgggcgtatttttctcaaccaatggttgccgcagctgtcatt
gtccacctggtgacggatgggacatattatggggaccaaaagcaggagaccatcagcgtg
cagctgcttgataccaaagatcagagccacgatctaggcctccatgtcctgagctgcagg
aacaatcccctgattatccctgtggtccatgacctcagccagcccttctaccacagccag
gcggtacgtgtgagcttcagttcgcccctggtcgccatctcgggggtggccctccgttcc
ttcgacaactttgaccccgtcaccctgagcagctgccagagaggggagacctacagccct
gccgagcagagctgcgtgcacttcgcatgtgagaaaactgactgtccagagctggctgtg
gagaatgcttctctcaattgctccagcagcgaccgctaccacggtgcccagtgtactgtg
agctgccggacaggctacgtgctccagatacggcgggatgatgagctgatcaagagccag
acgggacccagcgtcacagtgacctgtacagagggcaagtggaataagcaggtggcctgt
gagccagtcgactgcagcatcccagatcaccatcaagtctatgctgcctccttctcctgc
cctgagggcaccacctttggcagtcaatgttccttccagtgccgtcaccctgcacaattg
aaaggcaacaacagcctcctgacctgcatggaggatgggctgtggtccttcccagaggcc
ctgtgtgagctcatgtgcctcgctccaccccctgtgcccaatgcagacctccagaccgcc
cggtgccgagagaataagcacaaggtgggctccttctgcaaatacaaatgcaagcctgga
taccatgtgcctggatcctctcggaagtcaaagaaacgggccttcaagactcagtgtacc
caggatggcagctggcaggagggagcttgtgttcctgtgacctgtgacccacctccacca
aaattccatgggctctaccagtgtactaatggcttccagttcaacagtgagtgtaggatc
aagtgtgaagacagtgatgcctcccagggacttgggagcaatgtcattcattgccggaaa
gatggcacctggaacggctccttccatgtctgccaggagatgcaaggccagtgctcggtt
ccaaacgagctcaacagcaacctcaaactgcagtgccctgatggctatgccatagggtcg
gagtgtgccacctcgtgcctggaccacaacagcgagtccatcatcctgccaatgaacgtg
accgtgcgtgacatcccccactggctgaaccccacacgggtagagagagttgtctgcact
gctggtctcaagtggtatcctcaccctgctctgattcactgtgtcaaaggctgtgagccc
ttcatgggagacaattattgtgatgccatcaacaaccgagccttttgcaactatgacggt
ggggattgctgcacctccacagtgaagaccaaaaaggtcaccccattccctatgtcctgt
gatctacaaggtgactgtgcttgtcgggacccccaggcccaagaacacagccggaaagac
ctccggggatacagccatggctaa

DBGET integrated database retrieval system