KEGG   Homo sapiens (human): 50700Help
Entry
50700             CDS       T01001                                 

Gene name
RDH8, PRRDH, SDR28C2
Definition
(RefSeq) retinol dehydrogenase 8
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    50700 (RDH8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     50700 (RDH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b DUF1776
Motif
Other DBs
NCBI-GeneID: 50700
NCBI-ProteinID: NP_056540
OMIM: 608575
HGNC: 14423
Ensembl: ENSG00000080511
Vega: OTTHUMG00000180392
Pharos: Q9NYR8(Tbio)
UniProt: Q9NYR8 K7ELF7
Position
19p13.2
AA seq 311 aa AA seqDB search
MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTL
TVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVR
LVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFI
SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQ
AIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLS
CGCLPTRVRPR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcaccccggactgtgttgatctccggctgctcatcaggaattggtctggaa
cttgcagtgcaactggcccatgaccccaagaagcgctaccaggtcgtggccaccatgagg
gacctggggaagaaggagacactggaggcagctgctggggaggctctggggcagaccctc
accgtggcccagctggacgtgtgcagtgatgagtcggtggcccagtgtctcagctgtatc
cagggagaagtggacgtgctggtgaataatgctggaatgggcctggtggggcccctggag
gggctcagccttgctgccatgcagaatgtctttgacaccaactttttcggagctgtccgt
ctcgtcaaagctgtgcttccaggcatgaagaggaggcggcagggccacatcgtggtgatc
agcagtgtcatgggcctgcagggtgtcatcttcaacgatgtctatgcagcttccaagttc
gccctggagggattcttcgaaagcctcgctatccagctgctgcagttcaacatcttcatc
tccctggtggagccaggccccgtggtcaccgagtttgaggggaagcttctggcgcaggtt
tctatggctgagttcccaggcactgaccctgagaccctgcactacttccgggacctctat
ctcccagcctccaggaagctgttttgctccgtgggacagaacccacaggacgtggttcag
gccattgtcaacgtcatcagctcgactcgaccacccctgcgccgacagaccaacatccgc
tactcgccgctgaccacgctcaaaaccgtggattcctctggcagcctgtatgtgcgaacg
acccaccgcctcctcttccgctgtccacgcctcctcaaccttggccttcaatgtctgtcc
tgcggctgcctcccaacgcgggtgcggccaagatga

DBGET integrated database retrieval system