KEGG   Homo sapiens (human): 5071Help
Entry
5071              CDS       T01001                                 

Gene name
PRKN, AR-JP, LPRS2, PARK2, PDJ
Definition
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  parkin [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Disease
H00057  Parkinson disease
H00344  Leprosy
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5071 (PRKN)
   04120 Ubiquitin mediated proteolysis
    5071 (PRKN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    5071 (PRKN)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    5071 (PRKN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5071 (PRKN)
   04121 Ubiquitin system [BR:hsa04121]
    5071 (PRKN)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5071 (PRKN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     5071 (PRKN)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    5071 (PRKN)
  Aggrephagy
   Other aggrephagy associated proteins
    5071 (PRKN)
  Xenophagy
   Other xenophagy associated proteins
    5071 (PRKN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    5071 (PRKN)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    5071 (PRKN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_14 zf-RING_12 ubiquitin IBR Rad60-SLD Rad60-SLD_2 DUF2407
Motif
Other DBs
NCBI-GeneID: 5071
NCBI-ProteinID: NP_004553
OMIM: 602544
HGNC: 8607
Ensembl: ENSG00000185345
Vega: OTTHUMG00000015970
Pharos: O60260(Tbio)
UniProt: O60260 X5DR79
Structure
PDB: 

Position
6q26
AA seq 465 aa AA seqDB search
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag
ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac
ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg
aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag
agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct
gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga
tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga
aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca
tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac
tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag
gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg
tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc
ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac
cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag
ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca
gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg
ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt
gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta
tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag
gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc
tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag
tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac
cactggttcgacgtgtag

DBGET integrated database retrieval system