KEGG   Homo sapiens (human): 50717Help
Entry
50717             CDS       T01001                                 

Gene name
DCAF8, GAN2, H326, WDR42A
Definition
(RefSeq) DDB1 and CUL4 associated factor 8
  KO
K11804  WD repeat-containing protein 42A
Organism
hsa  Homo sapiens (human)
Disease
H01259  Giant axonal neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    50717 (DCAF8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     50717 (DCAF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 50717
NCBI-ProteinID: NP_056541
OMIM: 615820
HGNC: 24891
Ensembl: ENSG00000132716
Vega: OTTHUMG00000031604
Pharos: Q5TAQ9(Tdark)
UniProt: Q5TAQ9 B7Z8C9
Position
1q23.2
AA seq 597 aa AA seqDB search
MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRT
STESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQR
KRANRDQDSSDDERALEDWVSSETSALPRPRWQALPALRERELGSSARFVYEACGARVFV
QRFRLQHGLEGHTGCVNTLHFNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKSNVF
QAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHKLALEPDSPCTFL
SAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVGGRDQFVRIYD
QRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSD
GAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGV
VNCLEPHPHLPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLF
DSHMLWFLMHHLRQRRHHRRWREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaagggagcagcacagatggcagaacagacttagctaatggaagcctgtct
agcagtccagaggagatgtctggagctgaagaggggagggagacatcctcaggcattgaa
gtggaggcctcagacctgagtttgagcttgactggggatgatggtggccccaaccgcacc
agcacagaaagtcgaggcacagacacagagagctcaggtgaagataaggactctgacagc
atggaggacactggtcattactccattaatgatgaaaatcgagtccatgaccgctcagag
gaagaggaagaggaggaagaagaggaggaagaagagcagcctcggcgccgtgtacagcgc
aagcgggctaaccgtgaccaggactcatcagatgatgagcgggccctagaggactgggtg
tcctcagaaacatcagctctaccccgacctcgctggcaagccctccctgcccttcgggag
cgggagctgggttcaagtgcccgctttgtctatgaggcctgtggggcaagagtctttgtg
cagcgtttccgcctgcagcatgggcttgagggccatactggttgtgtcaataccctgcac
tttaaccagcgcggcacctggctggccagtggcagcgatgacctgaaggtggtggtgtgg
gattgggtacggcggcagccagtactggactttgagagtggccacaaaagtaatgtgttc
caggccaagtttcttcctaacagtggtgattctactctggccatgtgtgcccgtgacggg
caggttcgagtagcagaactgtctgccacacagtgttgcaagaatacaaaacgtgtggcc
cagcacaagggagcgtcccacaagttggcactggaaccagactctccctgtacgttctta
tctgcaggtgaagatgcagttgttttcaccattgacctgagacaagaccgcccagcgtcg
aaactggtggtgacaaaagagaaagagaagaaagtggggctgtatacgatctatgtgaat
cctgccaatacccaccagtttgcagtgggtggacgagatcagtttgtaaggatttatgac
cagaggaaaattgatgagaatgagaacaatggagtactcaagaagttctgtcctcatcac
ctggtgaacagtgagtccaaagcaaacatcacctgtcttgtgtacagccacgacggcaca
gagctcctggccagttacaatgatgaagacatttacctcttcaactcctctcacagtgat
ggggcccagtatgttaagagatacaagggccacagaaataatgccacagtaaaaggcgtc
aatttctatggccccaagagtgagtttgtggtgagcggtagtgactgtgggcacatcttc
ctctgggagaaatcatcctgccagattattcagttcatggagggggacaagggaggcgtg
gtaaactgtcttgagccccaccctcacctgcctgtgctggcaaccagtggcctagaccat
gatgtgaagatctgggcacccacagctgaagcttccactgagctgacagggttaaaagat
gtgattaagaagaacaagcgggagcgggatgaagatagcttgcaccaaactgacctgttt
gatagtcacatgctgtggttccttatgcatcacctgagacagagacgccatcaccggcgc
tggcgagaacctggggttggggccacagacgcggactctgatgagtctcccagctcctca
gacacatcggacgaggaggagggccctgaccgggtgcagtgcatgccatcttga

DBGET integrated database retrieval system