KEGG   Homo sapiens (human): 50805Help
Entry
50805             CDS       T01001                                 

Gene name
IRX4, IRXA3
Definition
(RefSeq) iroquois homeobox 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain MRP-S32
Motif
Other DBs
NCBI-GeneID: 50805
NCBI-ProteinID: NP_001265561
OMIM: 606199
HGNC: 6129
Ensembl: ENSG00000113430
Vega: OTTHUMG00000090411
Pharos: P78413(Tbio)
UniProt: P78413
Position
5p15.33
AA seq 519 aa AA seqDB search
MSYPQFGYPYSSAPQFLMATNSLSTCCESGGRTLADSGPAASAQAPVYCPVYESRLLATA
RHELNSAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGLAPAAA
AYYPYEPALGQYPYDRYGTMDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAI
ITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCADEKRPYAEGEEEEGGEEEAREEPLK
SSKNAEPVGKEEKELELSDLDDFDPLEAEPPACELKPPFHSLDGGLERVPAAPDGPVKEA
SGALRMSLAAGGGAALDEDLERARSCLRSAAAGPEPLPGAEGGPQVCEAKLGFVPAGASA
GLEAKPRIWSLAHTATAAAAAATSLSQTEFPSCMLKRQGPAAPAAVSSAPATSPSVALPH
SGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKGALLDPGPLGRSLGAGANV
LTAPLARAFPPAVPQDAPAAGAARELLALPKAGGKPFCA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacccgcagtttggatacccctactcctcggctccccagttcttgatggccacc
aactccctgagcacgtgctgcgagtccggaggccgcacgctggcggactccgggcccgcc
gcctcggcccaggcgccggtctactgcccggtctacgagagccggctgctggccaccgcg
cgccacgagctcaactcggccgcggcgctgggcgtctatgggggtccctatggcggatcg
cagggctatggcaactacgtgacctacggctcggaggcgtccgccttctactcgctgaac
agctttgattccaaggatggttcgggatctgcgcatgggggcctggcaccagccgctgcc
gcctactacccttacgagccagctctgggccagtacccctatgacaggtatggaaccatg
gacagcggcacgcggcgcaagaacgccacgcgcgagaccaccagcacgctcaaggcctgg
ctgcaggagcaccgcaagaacccctaccccaccaagggcgagaagatcatgctggccatc
atcaccaagatgaccctcacacaggtctccacctggttcgccaacgcgcgccggcgcctc
aagaaggagaacaagatgacgtggccgccgcggaacaagtgcgcagacgagaagcggccc
tacgcggagggcgaggaggaggaggggggcgaggaggaggcgcgggaggagcccctcaag
agctccaagaacgcagagcccgtgggcaaagaggagaaggagctggagcttagtgacttg
gacgacttcgacccgctggaagcagagccgccggcgtgcgagctgaagccgcccttccac
tccctggacggcggtctggagcgcgtccccgccgcgcccgacggcccggtcaaggaggcc
tcaggcgcgctccggatgtctctggccgcgggtggcggagctgctctggacgaggacctg
gagagggcccggagctgtctccgcagcgcggcggccgggccggagccactgccgggcgca
gagggcggccctcaggtctgcgaggccaagctggggtttgtgccggcgggggcgtcggca
ggcctggaggctaagccgcgcatctggtccctggcccacacagccaccgccgccgccgcc
gccgccacctccctgagccagactgagtttccgtcgtgcatgctcaagcgccaaggtccc
gcggcccctgcggctgtgtcctccgcgcccgccacgtccccgtctgtggcccttccccac
tctggcgccctggacaggcaccaggactccccggtaaccagtctcagaaactgggtggac
ggggtcttccacgaccccatcctcaggcacagcactttgaaccaggcctgggccaccgcc
aagggcgccctcctggaccccgggcctctgggacgctcgctgggggcgggcgcgaacgtg
ctgactgcacccctggcccgcgcctttccgcctgccgtgccccaggacgccccagctgca
ggcgccgccagggagctgctcgccctgcccaaggccggcggcaaacccttctgcgcctga

DBGET integrated database retrieval system