KEGG   Homo sapiens (human): 50810Help
Entry
50810             CDS       T01001                                 

Gene name
HDGFL3, CGI-142, HDGF-2, HDGF2, HDGFRP3, HRP-3
Definition
(RefSeq) HDGF like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 50810
NCBI-ProteinID: NP_057157
OMIM: 616643
HGNC: 24937
Ensembl: ENSG00000166503
Vega: OTTHUMG00000172685
Pharos: Q9Y3E1(Tdark)
UniProt: Q9Y3E1 A0A024R216
Position
15q25.2
AA seq 203 aa AA seqDB search
MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPK
DLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADA
SSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSS
EGGDAGNDTRNTTSDLQKTSEGT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtccgcggccccgcgagtacaaagcgggcgacctggtcttcgccaagatgaag
ggctacccgcactggccggcccggattgatgaactcccagagggcgctgtgaagcctcca
gcaaacaagtatcctatcttcttttttggcacccatgaaactgcatttctaggtcccaaa
gacctttttccatataaggagtacaaagacaagtttggaaagtcaaacaaacggaaagga
tttaacgaaggattgtgggaaatagaaaataacccaggagtaaagtttactggctaccag
gcaattcagcaacagagctcttcagaaactgagggagaaggtggaaatactgcagatgca
agcagtgaggaagaaggtgatagagtagaagaagatggaaaaggcaaaagaaagaatgaa
aaagcaggctcaaaacggaaaaagtcatatacttcaaagaaatcctctaaacagtcccgg
aaatctccaggagatgaagatgacaaagactgcaaagaagaggaaaacaaaagcagctct
gagggtggagatgcgggcaacgacacaagaaacacaacttcagacttgcagaaaaccagt
gaagggacctaa

DBGET integrated database retrieval system