KEGG   Homo sapiens (human): 50813Help
Entry
50813             CDS       T01001                                 

Gene name
COPS7A, CSN7, CSN7A, SGN7a
Definition
(RefSeq) COP9 signalosome subunit 7A
  KO
K12180  COP9 signalosome complex subunit 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    50813 (COPS7A)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    50813 (COPS7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN7a_helixI PCI
Motif
Other DBs
NCBI-GeneID: 50813
NCBI-ProteinID: NP_001157565
OMIM: 616009
HGNC: 16758
Ensembl: ENSG00000111652
Vega: OTTHUMG00000169182
Pharos: Q9UBW8(Tbio)
UniProt: Q9UBW8
Structure
PDB: 

Position
12p13.31
AA seq 275 aa AA seqDB search
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLT
ELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggaagtgaaggtgacagggcagaaccaggagcaatttctgctcctagccaag
tcggccaagggggcagcgctggccacactcatccatcaggtgctggaggcccctggtgtc
tacgtgtttggagaactgctggacatgcccaatgttagagagctggctgagagtgacttt
gcctctaccttccggctgctcacagtgtttgcttatgggacatacgctgactacttagct
gaagcccggaatcttcctccactaacagaggctcagaagaataagcttcgacacctctca
gttgtcaccctggctgctaaagtaaagtgtatcccatatgcagtgttgctggaggctctt
gccctgcgtaatgtgcggcagctggaagaccttgtgattgaggctgtgtatgctgacgtg
cttcgtggctccctggaccagcgcaaccagcggctcgaggttgactacagcatcgggcgg
gacatccagcgccaggacctcagtgccattgcccgaaccctgcaggaatggtgtgtgggc
tgtgaggtcgtgctgtcaggcattgaggagcaggtgagccgtgccaaccaacacaaggag
cagcagctgggcctgaagcagcagattgagagtgaggttgccaaccttaaaaaaaccatt
aaagttacgacggcagcagcagccgcagccacatctcaggaccctgagcaacacctgact
gagctgagggaaccagctcctggcaccaaccagcgccagcccagcaagaaagcctcaaag
ggcaaggggctccgagggagcgccaagatttggtccaagtcgaattga

DBGET integrated database retrieval system