KEGG   Homo sapiens (human): 50832
Entry
50832             CDS       T01001                                 

Gene name
TAS2R4, T2R4
Definition
(RefSeq) taste 2 receptor member 4
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50832 (TAS2R4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50832 (TAS2R4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50832 (TAS2R4)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50832
NCBI-ProteinID: NP_058640
OMIM: 604869
HGNC: 14911
Ensembl: ENSG00000127364
Vega: OTTHUMG00000157634
Pharos: Q9NYW5(Tbio)
UniProt: Q9NYW5
Position
7q34
AA seq 299 aa
MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLG
LFLVNTIYFVSSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLL
LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVS
LVLSSSLQFIINVTSASLLIHSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYI
PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttcggttattctatttctctgctattattgcctcagttattttaaattttgtagga
atcattatgaatctgtttattacagtggtcaattgcaaaacttgggtcaaaagccataga
atctcctcttctgataggattctgttcagcctgggcatcaccaggtttcttatgctggga
ctatttctggtgaacaccatctacttcgtctcttcaaatacggaaaggtcagtctacctg
tctgctttttttgtgttgtgtttcatgtttttggactcgagcagtgtctggtttgtgacc
ttgctcaatatcttgtactgtgtgaagattactaacttccaacactcagtgtttctcctg
ctgaagcggaatatctccccaaagatccccaggctgctgctggcctgtgtgctgatttct
gctttcaccacttgcctgtacatcacgcttagccaggcatcaccttttcctgaacttgtg
actacgagaaataacacatcatttaatatcagtgagggcatcttgtctttagtggtttct
ttggtcttgagctcatctctccagttcatcattaatgtgacttctgcttccttgctaata
cactccttgaggagacatatacagaagatgcagaaaaatgccactggtttctggaatccc
cagacggaagctcatgtaggtgctatgaagctgatggtctatttcctcatcctctacatt
ccatattcagttgctaccctggtccagtatctccccttttatgcagggatggatatgggg
accaaatccatttgtctgatttttgccaccctttactctccaggacattctgttctcatt
attatcacacatcctaaactgaaaacaacagcaaagaagattctttgtttcaaaaaatag

DBGET integrated database retrieval system