KEGG   Homo sapiens (human): 50833Help
Entry
50833             CDS       T01001                                 

Gene name
TAS2R16, BGLPT, T2R16
Definition
(RefSeq) taste 2 receptor member 16
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Disease
H01611  Alcohol dependence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50833 (TAS2R16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50833 (TAS2R16)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50833 (TAS2R16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAS2R
Motif
Other DBs
NCBI-GeneID: 50833
NCBI-ProteinID: NP_058641
OMIM: 604867
HGNC: 14921
Ensembl: ENSG00000128519
Vega: OTTHUMG00000157090
Pharos: Q9NYV7(Tbio)
UniProt: Q9NYV7
Position
7q31.32; 7q31
AA seq 291 aa AA seqDB search
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ
WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW
RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA
HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF
LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatacccatccaactcactgtcttcttcatgatcatctatgtgcttgagtccttgaca
attattgtgcagagcagcctaattgttgcagtgctgggcagagaatggctgcaagtcaga
aggctgatgcctgtggacatgattctcatcagcctgggcatctctcgcttctgtctacag
tgggcatcaatgctgaacaatttttgctcctattttaatttgaattatgtactttgcaac
ttaacaatcacctgggaattttttaatatccttacattctggttaaacagcttgcttacc
gtgttctactgcatcaaggtctcttctttcacccatcacatctttctctggctgaggtgg
agaattttgaggttgtttccctggatattactgggttctctgatgattacttgtgtaaca
atcatcccttcagctattgggaattacattcaaattcagttactcaccatggagcatcta
ccaagaaacagcactgtaactgacaaacttgaaaattttcatcagtatcagttccaggct
catacagttgcattggttattcctttcatcctgttcctggcctccaccatctttctcatg
gcatcactgaccaagcagatacaacatcatagcactggtcactgcaatccaagcatgaaa
gcgcgcttcactgccctgaggtcccttgccgtcttatttattgtgtttacctcttacttt
ctaaccatactcatcaccattataggtactctatttgataagagatgttggttatgggtc
tgggaagcttttgtctatgctttcatcttaatgcattccacttcactgatgctgagcagc
cctacgttgaaaaggattctaaagggaaagtgctag

DBGET integrated database retrieval system