KEGG   Homo sapiens (human): 50838
Entry
50838             CDS       T01001                                 

Gene name
TAS2R13, T2R13, TRB3
Definition
(RefSeq) taste 2 receptor member 13
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50838 (TAS2R13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50838 (TAS2R13)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50838 (TAS2R13)
SSDB
Motif
Pfam: TAS2R DUF1280
Other DBs
NCBI-GeneID: 50838
NCBI-ProteinID: NP_076409
OMIM: 604792
HGNC: 14919
Ensembl: ENSG00000212128
Vega: OTTHUMG00000168555
Pharos: Q9NYV9(Tbio)
UniProt: Q9NYV9
Position
12p13.2
AA seq 303 aa
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
AKR
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaaagtgccctgccgagtatcttcactcttgtaataattgcagaattcataattggg
aatttgagcaatggatttatagtactgatcaactgcattgactgggtcagtaaaagagag
ctgtcctcagtcgataaactcctcattatcttggcaatctccagaattgggctgatctgg
gaaatattagtaagttggtttttagctctgcattatctagccatatttgtgtctggaaca
ggattaagaattatgatttttagctggatagtttctaatcacttcaatctctggcttgct
acaatcttcagcatcttttatttgctcaaaatagcgagtttctctagccctgcttttctc
tatttgaagtggagagtaaacaaagtgattctgatgatactgctaggaaccttggtcttc
ttatttttaaatctgatacaaataaacatgcatataaaagactggctggaccgatatgaa
agaaacacaacttggaatttcagtatgagtgactttgaaacattttcagtgtcggtcaaa
ttcactatgactatgttcagtctaacaccatttactgtggccttcatctcttttctcctg
ttaattttctccctgcagaaacatctccagaaaatgcaactcaattacaaaggacacaga
gaccccaggaccaaggtccatacaaatgccttgaaaattgtgatctcattccttttattc
tatgctagtttctttctatgtgttctcatatcatggatttctgagctgtatcagaacaca
gtgatctacatgctttgtgagacgattggagtcttctctccttcaagccactcctttctt
ctgattctaggaaacgctaagttaagacaggcctttcttttggtggcagctaaggtatgg
gctaaacgatga

DBGET integrated database retrieval system