KEGG   Homo sapiens (human): 50846
Entry
50846             CDS       T01001                                 
Symbol
DHH, GDMN, GDXYM, HHG-3, SRXY7
Name
(RefSeq) desert hedgehog signaling molecule
  KO
K11990  desert hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00062  Hedgehog signaling pathway
N01537  Hedgehog signaling pathway, HH ligand secretion
N01538  Hedgehog signaling pathway, PTCH coreceptor
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50846 (DHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    50846 (DHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   50846 (DHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 50846
NCBI-ProteinID: NP_066382
OMIM: 605423
HGNC: 2865
Ensembl: ENSG00000139549
Pharos: O43323(Tbio)
UniProt: O43323
Structure
Position
12:complement(49086656..49094801)
AA seq 396 aa
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcc
cagagctgcgggccgggccgggggccggttggccggcgccgctatgcgcgcaagcagctc
gtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgggcgccagt
gggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaac
tacaaccccgacatcatcttcaaggatgaggagaacagtggagccgaccgcctgatgacc
gagcgttgtaaggagcgggtgaacgctttggccattgccgtgatgaacatgtggcccgga
gtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactc
cactacgaaggccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatggg
ttgctggcgcgcctcgcagtggaagccggcttcgactgggtctactacgagtcccgcaac
cacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgcttt
ccgggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcac
cgcggagactgggttttggcggccgatgcgtcaggccgggtggtgcccacgccggtgctg
ctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagaccgagtgg
cctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcg
cccgcgccaggcgactttgcaccggtgttcgcgcgccggctacgcgctggggactcggtg
ctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtgtggcgcgggaggaa
gccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctg
gcctcttgctacgcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttg
agactgctgcacgcgctaggggcgctgctccccggcggggccgtccagccgactggcatg
cattggtactctcggctcctctaccgcttagcggaggagctactgggctga

DBGET integrated database retrieval system