KEGG   Homo sapiens (human): 50846Help
Entry
50846             CDS       T01001                                 

Gene name
DHH, GDXYM, HHG-3, SRXY7
Definition
(RefSeq) desert hedgehog
  KO
K11990  desert hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Module
hsa_M00678  Hedgehog signaling
Disease
H00607  46,XY disorders of sex development (Disorders of gonadal development)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    50846 (DHH)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C46: hedgehog family
   50846 (DHH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Motif
Other DBs
NCBI-GeneID: 50846
NCBI-ProteinID: NP_066382
OMIM: 605423
HGNC: 2865
Ensembl: ENSG00000139549
Vega: OTTHUMG00000170408
Pharos: O43323(Tbio)
UniProt: O43323
Structure
PDB: 

Position
12q13.12
AA seq 396 aa AA seqDB search
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcc
cagagctgcgggccgggccgggggccggttggccggcgccgctatgcgcgcaagcagctc
gtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgggcgccagt
gggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaac
tacaaccccgacatcatcttcaaggatgaggagaacagtggagccgaccgcctgatgacc
gagcgttgtaaggagcgggtgaacgctttggccattgccgtgatgaacatgtggcccgga
gtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactc
cactacgaaggccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatggg
ttgctggcgcgcctcgcagtggaagccggcttcgactgggtctactacgagtcccgcaac
cacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgcttt
ccgggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcac
cgcggagactgggttttggcggccgatgcgtcaggccgggtggtgcccacgccggtgctg
ctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagaccgagtgg
cctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcg
cccgcgccaggcgactttgcaccggtgttcgcgcgccggctacgcgctggggactcggtg
ctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtgtggcgcgggaggaa
gccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctg
gcctcttgctacgcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttg
agactgctgcacgcgctaggggcgctgctccccggcggggccgtccagccgactggcatg
cattggtactctcggctcctctaccgcttagcggaggagctactgggctga

DBGET integrated database retrieval system