KEGG   Homo sapiens (human): 50846
Entry
50846             CDS       T01001                                 

Gene name
DHH, GDMN, GDXYM, HHG-3, SRXY7
Definition
(RefSeq) desert hedgehog signaling molecule
  KO
K11990  desert hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50846 (DHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    50846 (DHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   50846 (DHH)
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 50846
NCBI-ProteinID: NP_066382
OMIM: 605423
HGNC: 2865
Ensembl: ENSG00000139549
Vega: OTTHUMG00000170408
Pharos: O43323(Tbio)
UniProt: O43323
Structure
PDB: 
2WFQ 3N1G 2WFR 2WG3 3N1Q

Position
12q13.12
AA seq 396 aa
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcc
cagagctgcgggccgggccgggggccggttggccggcgccgctatgcgcgcaagcagctc
gtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgggcgccagt
gggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaac
tacaaccccgacatcatcttcaaggatgaggagaacagtggagccgaccgcctgatgacc
gagcgttgtaaggagcgggtgaacgctttggccattgccgtgatgaacatgtggcccgga
gtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactc
cactacgaaggccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatggg
ttgctggcgcgcctcgcagtggaagccggcttcgactgggtctactacgagtcccgcaac
cacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgcttt
ccgggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcac
cgcggagactgggttttggcggccgatgcgtcaggccgggtggtgcccacgccggtgctg
ctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagaccgagtgg
cctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcg
cccgcgccaggcgactttgcaccggtgttcgcgcgccggctacgcgctggggactcggtg
ctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtgtggcgcgggaggaa
gccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctg
gcctcttgctacgcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttg
agactgctgcacgcgctaggggcgctgctccccggcggggccgtccagccgactggcatg
cattggtactctcggctcctctaccgcttagcggaggagctactgggctga

DBGET integrated database retrieval system