KEGG   Homo sapiens (human): 50848
Entry
50848             CDS       T01001                                 

Symbol
F11R, CD321, JAM, JAM1, JAMA, JCAM, KAT, PAM-1
Name
(RefSeq) F11 receptor
  KO
K06089  junctional adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    50848 (F11R)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    50848 (F11R)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    50848 (F11R)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50848 (F11R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    50848 (F11R)
CD molecules [BR:hsa04090]
 Proteins
  50848 (F11R)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Ig_6 C1-set C2-set_2 Ig_C17orf99 Adeno_E3_CR1 V-set_CD47 DUF5626
Other DBs
NCBI-GeneID: 50848
NCBI-ProteinID: NP_058642
OMIM: 605721
HGNC: 14685
Ensembl: ENSG00000158769
Vega: OTTHUMG00000028602
Pharos: Q9Y624(Tbio)
UniProt: Q9Y624 Q6FIB4
Structure
PDB: 
1NBQ 4ODB 3EOY

Position
1q23.3
AA seq 299 aa
MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYG
EVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
AAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
NT seq 900 nt   +upstreamnt  +downstreamnt
atggggacaaaggcgcaagtcgagaggaaactgttgtgcctcttcatattggcgatcctg
ttgtgctccctggcattgggcagtgttacagtgcactcttctgaacctgaagtcagaatt
cctgagaataatcctgtgaagttgtcctgtgcctactcgggcttttcttctccccgtgtg
gagtggaagtttgaccaaggagacaccaccagactcgtttgctataataacaagatcaca
gcttcctatgaggaccgggtgaccttcttgccaactggtatcaccttcaagtccgtgaca
cgggaagacactgggacatacacttgtatggtctctgaggaaggcggcaacagctatggg
gaggtcaaggtcaagctcatcgtgcttgtgcctccatccaagcctacagttaacatcccc
tcctctgccaccattgggaaccgggcagtgctgacatgctcagaacaagatggttcccca
ccttctgaatacacctggttcaaagatgggatagtgatgcctacgaatcccaaaagcacc
cgtgccttcagcaactcttcctatgtcctgaatcccacaacaggagagctggtctttgat
cccctgtcagcctctgatactggagaatacagctgtgaggcacggaatgggtatgggaca
cccatgacttcaaatgctgtgcgcatggaagctgtggagcggaatgtgggggtcatcgtg
gcagccgtccttgtaaccctgattctcctgggaatcttggtttttggcatctggtttgcc
tatagccgaggccactttgacagaacaaagaaagggacttcgagtaagaaggtgatttac
agccagcctagtgcccgaagtgaaggagaattcaaacagacctcgtcattcctggtgtga

DBGET integrated database retrieval system