KEGG   Homo sapiens (human): 5090Help
Entry
5090              CDS       T01001                                 

Gene name
PBX3
Definition
(RefSeq) PBX homeobox 3
  KO
K15610  pre-B-cell leukemia transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    5090 (PBX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5090 (PBX3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, PBC
    5090 (PBX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin Sec15 LZ3wCH
Motif
Other DBs
NCBI-GeneID: 5090
NCBI-ProteinID: NP_006186
OMIM: 176312
HGNC: 8634
Ensembl: ENSG00000167081
Vega: OTTHUMG00000020684
Pharos: P40426(Tbio)
UniProt: P40426 Q96AL5
Position
9q33.3
AA seq 434 aa AA seqDB search
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS
LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV
SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH
VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR
NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD
SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS
PTEGPGSVHSDTSN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaatccaggatgctgcagactctggccggggtgaacctggctggccactcg
gtgcaggggggcatggccctgccgcctcccccgcacggccacgaaggggcggacggcgac
ggcaggaagcaggacatcggcgacatcctccaccagatcatgaccatcaccgaccagagc
ttggacgaggcgcaagcaaagaaacatgccctgaactgtcacagaatgaaaccagcgctc
ttcagcgtcctgtgtgagatcaaagagaaaacaggtctcagcatcagaggagcccaggag
gaggaccctcccgatccccagctaatgagactggacaatatgcttttggcagaaggggtt
tcaggtcctgagaaaggtgggggatcggcggcagcagctgcagccgcggcagcctctgga
ggttcttcagataactctattgaacactcagattacagagccaaattgacccagatcaga
caaatctatcacacagaactggagaaatatgaacaggcatgtaatgaatttactacacat
gtgatgaaccttctccgagaacagagtagaacacgtcccatttctccaaaagagattgaa
agaatggtgggcatcatccatcgaaaatttagttccattcagatgcagctcaaacaaagc
acttgtgaagcagttatgattttaagatcaaggttccttgatgccagacggaaaaggcgt
aacttcagtaaacaggccacagaaatcttgaatgaatatttttactcacacctcagcaac
ccctaccccagtgaagaagccaaagaggagctggccaagaaatgcagcatcacagtgtca
caggtatccaattggtttggcaacaaacgaatcaggtacaagaagaacattggcaagttt
caggaagaagccaacctctatgctgcaaagacggccgtgacagctgcacacgcagtagca
gcagctgtgcagaacaaccagaccaattcgcccaccacaccaaattccggttcttctggt
tcttttaacctcccaaattctggggacatgttcatgaacatgcagagtctgaatggggat
tcttaccaagggtcccaagtcggagccaatgtgcaatcacaggtggataccctccgtcat
gttatcaatcagacgggaggctacagtgatggccttggaggaaattcactgtacagtcca
cataatttaaatgctaatggaggctggcaggacgcaacaactccatcttctgtgacttct
cctacagaaggcccaggaagtgtgcactcggatacctctaactaa

DBGET integrated database retrieval system