KEGG   Homo sapiens (human): 5091Help
Entry
5091              CDS       T01001                                 

Gene name
PC, PCB
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Disease
H00073  Pyruvate carboxylase deficiency
H01400  Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    5091 (PC)
   00620 Pyruvate metabolism
    5091 (PC)
Enzymes [BR:hsa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     5091 (PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 PTS_EIIA_1
Motif
Other DBs
NCBI-GeneID: 5091
NCBI-ProteinID: NP_000911
OMIM: 608786
HGNC: 8636
Ensembl: ENSG00000173599
Vega: OTTHUMG00000167099
Pharos: P11498(Tbio)
UniProt: P11498 A0A024R5C5
Structure
PDB: 

Position
11q13.2
AA seq 1178 aa AA seqDB search
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELG
IRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGF
LSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIE
KPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAK
QVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQF
IDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAG
FRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSK
LFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVF
KFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSL
QYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGV
AAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEG
ARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQM
LGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFP
EPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHF
KDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFEL
NGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVL
SAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttccgaacagtccatgggggcctgaggctcctgggaatccgccgaacctcc
accgcccccgctgcctccccaaatgtccggcgcctggagtataagcccatcaagaaagtc
atggtggccaacagaggtgagattgccatccgtgtgttccgggcctgcacggagctgggc
atccgcaccgtagccatctactctgagcaggacacgggccagatgcaccggcagaaagca
gatgaagcctatctcatcggccgcggcctggcccccgtgcaggcctacctgcacatccca
gacatcatcaaggtggccaaggagaacaacgtagatgcagtgcaccctggctacgggttc
ctctctgagcgagcggacttcgcccaggcctgccaggatgcaggggtccggtttattggg
ccaagcccagaagtggtccgcaagatgggagacaaggtggaggcccgggccatcgccatt
gctgcgggtgttcccgttgtccctggcacagatgcccccatcacgtccctgcatgaggcc
cacgagttctccaacacctacggcttccccatcatcttcaaggcggcctatgggggtgga
gggcgtggcatgagggtggtgcacagctacgaggagctggaggagaattacacccgggcc
tactcagaggctctggccgcctttgggaatggggcgctgtttgtggagaagttcatcgag
aagccacggcacatcgaggtgcagatcttgggggaccagtatgggaacatcctgcacctg
tacgagcgagactgctccatccagcggcggcaccagaaggtggtcgagattgcccccgcc
gcccacctggacccgcagcttcggactcggctcaccagcgactctgtgaaactcgctaaa
caggtgggctacgagaacgcaggcaccgtggagttcctggtggacaggcacggcaagcac
tacttcatcgaggtcaactcccgcctgcaggtggagcacacggtcacagaggagatcacc
gacgtagacctggtccatgctcagatccacgtggctgagggcaggagcctacccgacctg
ggcctgcggcaggagaacatccgcatcaacgggtgtgccatccagtgccgggtcaccacc
gaggaccccgcgcgcagcttccagccggacaccggccgcattgaggtgttccggagcgga
gagggcatgggcatccgcctggataatgcttccgccttccaaggagccgtcatctcgccc
cactacgactccctgctggtcaaagtcattgcccacggcaaagaccaccccacggccgcc
accaagatgagcagggcccttgcggagttccgcgtccgaggtgtgaagaccaacatcgcc
ttcctgcagaatgtgctcaacaaccagcagttcctggcaggcactgtggacacccagttc
atcgacgagaacccagagctgttccagctgcggcctgcacagaaccgggcccaaaagctg
ttgcactacctcggccatgtcatggtaaacggtccaaccaccccgattcccgtcaaggcc
agccccagccccacggaccccgttgtccctgcagtgcccataggcccgcccccggctggt
ttcagagacatcctgctgcgagaggggcctgagggctttgctcgagctgtgcggaaccac
ccggggctgctgctgatggacacgaccttcagggacgcccaccagtcactgctggccact
cgtgtgcgcacccacgatctcaaaaagatcgccccctatgttgcccacaacttcagcaag
ctcttcagcatggagaactggggaggagccacgtttgacgtcgccatgcgcttcctgtat
gagtgcccctggcggcggctgcaggagctccgggagctcatccccaacatccctttccag
atgctgctgcggggggccaatgctgtgggctacaccaactacccagacaacgtggtcttc
aagttctgtgaagtggccaaagagaatggcatggatgtcttccgtgtgtttgactccctc
aactacttgcccaacatgctgctgggcatggaggcggcaggaagtgccggaggcgtggtg
gaggctgccatctcatacacgggcgacgtggccgaccccagccgcaccaagtactcactg
cagtactacatgggcttggccgaagagctggtgcgagctggcacccacatcctgtgcatc
aaggacatggccgggctgctgaagcccacggcctgcaccatgctggtcagctccctccgg
gaccgcttccccgacctcccactgcacatccacacccacgacacgtcaggggcaggcgtg
gcagccatgctggcctgtgcccaggctggagctgatgtggtggatgtggcagctgattcc
atgtctgggatgacttcacagcccagcatgggggccctggtggcctgtaccagagggact
cccctggacacagaggtgcccatggagcgcgtgtttgactacagtgagtactgggagggg
gctcggggactgtacgcggccttcgactgcacggccaccatgaagtctggcaactcggac
gtgtatgaaaatgagatcccagggggccagtacaccaacctgcacttccaggcccacagc
atggggcttggctccaagttcaaggaggtcaagaaggcctatgtggaggccaaccagatg
ctgggcgatctcatcaaggtgacgccctcctccaagatcgtgggggacctggcccagttt
atggtgcagaatggattgagccgggcagaggccgaagctcaggcggaagagctgtccttt
ccccgctccgtggtggagttcctgcagggctacatcggtgtcccccatggggggttcccc
gaaccctttcgctctaaggtactgaaggacctgccaagggtggaggggcggcctggagcc
tccctccctcccctggatctgcaggcactggagaaggagctggtagaccggcatggggag
gaggtgacgccggaagatgtgctctcagcagctatgtaccccgatgtgtttgcccacttc
aaggacttcactgccacctttggccccctggatagcctgaatactcgcctcttcctgcag
ggacccaagatcgcagaggagtttgaggtggagctggagcggggcaagacgctgcacatc
aaagccctggccgtgagcgacctgaaccgggccggccagaggcaggtcttctttgagctc
aatgggcagctgcggtccatcttggtcaaggacacccaggccatgaaggagatgcacttc
caccccaaggccctaaaggacgtgaagggccagatcggggcgcccatgcctgggaaggtg
atagacatcaaagtggtggcaggggccaaggtggccaagggccagcccctgtgtgtgctc
agtgccatgaagatggagactgtggtgacctcacccatggagggtactgtccgcaaggtt
catgtgaccaaggacatgacactggaaggtgacgacctcatcctggagatcgagtga

DBGET integrated database retrieval system