KEGG   Homo sapiens (human): 5092Help
Entry
5092              CDS       T01001                                 

Gene name
PCBD1, DCOH, PCBD, PCD, PHS
Definition
(RefSeq) pterin-4 alpha-carbinolamine dehydratase 1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Disease
H00167  Phenylketonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5092 (PCBD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5092 (PCBD1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     5092 (PCBD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5092 (PCBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 5092
NCBI-ProteinID: NP_000272
OMIM: 126090
HGNC: 8646
Ensembl: ENSG00000166228
Vega: OTTHUMG00000018417
Pharos: P61457(Tbio)
UniProt: P61457
Position
10q22.1
AA seq 104 aa AA seqDB search
MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKL
DHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaaagcacacaggctgagcgctgaggagagggaccagctgctgccaaacctg
agggctgtggggtggaatgagctggaaggccgtgatgccatcttcaagcagtttcatttc
aaagacttcaacagggcctttgggttcatgacaagagtggccctgcaggctgagaaactg
gaccaccatcctgaatggtttaacgtgtacaacaaggtccacatcacgctgagcacccat
gagtgtgccggcctttcagaacgggacataaacctggccagcttcatcgaacaagtagca
gtgtccatgacatag

DBGET integrated database retrieval system