KEGG   Homo sapiens (human): 50937Help
Entry
50937             CDS       T01001                                 

Gene name
CDON, CDO, CDON1, HPE11, ORCAM
Definition
(RefSeq) cell adhesion associated, oncogene regulated
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50937 (CDON)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_6 Ig_5 Pur_ac_phosph_N C1-set Interfer-bind Glyco_hydro_76 TNFR_16_TM
Motif
Other DBs
NCBI-GeneID: 50937
NCBI-ProteinID: NP_001230526
OMIM: 608707
HGNC: 17104
Ensembl: ENSG00000064309
Vega: OTTHUMG00000165862
Pharos: Q4KMG0(Tbio)
UniProt: Q4KMG0
Structure
PDB: 

Position
11q24.2
AA seq 1287 aa AA seqDB search
MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRIS
WLHNGKTLDGNLEHVKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGD
FGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLEHSTENYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDVHILHPTHSQALAVLSRSPVT
LECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVK
YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQPIHPSARHLT
AGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQA
GASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDR
SKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
GKDGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSA
AGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVSEAANNNFGVVLTDSSRHSGV
PEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIPPSKLSV
EVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSD
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPAR
SSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYT
TLSGASQINGNVHGGFLTNGGLSSGYSHLHHKVPNAVNGIVNGSLNGGLYSGHSNSLTRT
HVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRCFTKTNSTFSSSPPPVVPVVA
PYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSD
GSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEG
CAEKTMWSPPGIPLDSPTEVLQQPRET
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggatcttggacccttatgtacactgctgtatgttactcttacaattctgtgc
tcttctgtgagttcagacttggcaccttattttacttctgagccgctctctgctgtccag
aaacttggtggacctgtagtactgcattgttctgctcaacctgtgaccactcgtatctca
tggctgcataacggaaaaacattggatggaaacctggaacatgttaagattcatcagggg
actctgacaattctttctctcaactcctctcttttgggttactaccagtgccttgccaac
aatagcatcggtgccattgtgagtggccctgcgacagtatctgtggcagttcttggtgat
tttggttcatccacaaagcatgttattacagcagaagaaaaaagtgctggtttcattggc
tgcagggtaccggagagtaaccccaaagctgaggtgcgctataaaatccggggaaaatgg
ctggaacattccacagagaattacttaatccttccatcaggaaatcttcagattttgaat
gtatccttagaggacaagggatcatacaaatgtgcagcttataatcctgtcacacatcaa
ttaaaagttgaacctattggccgaaagctccttgtgagtcgtccttcttcagatgatgtt
cacattcttcaccccacccattcacaggcattagctgttctttctcgtagccctgtaacc
ttggagtgtgtggtgagtggggtcccggctcctcaagtgtattggctaaaggacgggcag
gacattgcaccaggaagcaactggagaaggttgtattctcatcttgccactgatagcgtt
gacccggcggactccggaaactattcctgcatggcgggaaacaagtctggagatgtaaaa
tatgtgacttacatggttaatgtacttgaacatgcttccatttctaaaggactacaggat
cagatagtgtctctgggtgccacagtacactttacctgcgacgttcatgggaacccagcc
cccaactgtacctggtttcacaatgcacagcctattcatccttctgcacgacatctaact
gcaggaaacggactgaaaatcagtggggttactgtggaagatgttgggatgtatcagtgt
gtagcagataatgggattggatttatgcactctactggaagacttgaaattgaaaatgac
ggtggattcaagccagttataattacggcaccagtaagtgcaaaggttgcagacggagac
tttgttactctgtcctgcaatgccagtgggctgccggttccggtcattcgttggtatgac
agccatggattgataaccagccatccatctcaagtcctgagatcgaaatcccgaaaatca
cagttatcaagacctgagggcttgaacctggagcctgtgtacttcgtcctgtcccaagct
ggtgcaagctctctccatattcaggctgtgactcaggaacatgcggggaaatacatctgc
gaagctgcaaatgaacatggtaccacacaggcagaagcatctctcatggttgttcctttt
gaaacaaatacaaaagcagagacagtcacacttcctgatgctgctcagaatgatgacaga
agtaagagagatggttcagaaactgggttactgagctcatttccggtgaaggtccatccc
agtgcagtggaatcagcaccagagaaaaacgccagcggcatctctgttcctgatgccccc
atcatactgagccccccacagacccacacaccagacacgtacaacctggtgtggagggca
ggcaaggatggtgggctgcccatcaatgcttactttgtgaagtatcgaaagctggatgat
ggggttggcatgctgggaagctggcacacggttcgagtcccaggaagtgaaaatgagctc
catttagctgagctggagccatctagtctttatgaagtcttgatggtagcaagaagcgca
gcaggtgaaggccaacctgccatgcttaccttccgaaccagcaaagaaaaaacagcgtca
tcaaaaaacacccaggcatcctctccacccgtgggcatccctaagtatcccgttgtttca
gaggctgcaaacaacaattttggagtggtacttacagattcctctaggcacagtggagtt
ccagaggcaccagatcggcctaccatctccactgcatcagagacatcagtctatgtcact
tggattcctcgggcaaacgggggttctccaatcactgccttcaaagtcgaatataaacgg
atgaggaccagcaattggctggtggcagctgaagacatccctccttccaaactttcagtg
gaagttcgtagtttagaaccaggttcaacatacaaatttagggtcattgccatcaaccat
tatggtgagagttttcggagttcagcatctcgtccttatcaagtggttgggttccccaat
cgcttttccagccgtccaataactggacctcacattgcatacacagaggctgtcagcgat
actcagatcatgctaaagtggacgtacattccatcaagtaacaataacactcccattcaa
ggattttatatctattaccgaccaacagatagtgacaatgacagtgattacaagagggat
gttgtagaaggttcaaagcagtggcacatgattggccacctgcagccagaaacctcctat
gacattaaaatgcaatgcttcaatgaaggaggagaaagtgaatttagcaatgtgatgatc
tgcgagactaaagtgaaacgtgttcctggagcttctgaatatcctgtcaaagacttgagt
acccctccaaattctttgggaagtggaggaaatgtggggcctgcaaccagccctgccaga
agcagtgacatgttatatctgatcgttggctgtgtgctgggcgtcatggtcctcattctg
atggttttcattgcaatgtgcctgtggaagaatcgccagcagaataccatacaaaaatat
gacccaccaggatatctctaccaaggatcagatatgaacgggcagatggtggactacacc
actctctcaggagcaagtcagataaatggaaatgttcacggaggcttcctaaccaatggc
ggtctcagcagtggctattcccaccttcaccataaggtccccaatgcagtcaatggaatt
gtgaatgggagcctaaatggagggctttactccgggcacagcaactctctaaccaggaca
cacgtggattttgaacatcctcatcatctagtgaatggtggtggaatgtacacggccgtg
cctcagattgaccctctggagtgtgttaactgccgaaattgtcgaaacaacaataggtgt
ttcaccaaaaccaacagcactttcagcagcagccctcctcctgtggtccctgtggtagca
ccttatcctcaggatggtttggaaatgaagcccctcagtcacgtgaaggtgcctgtatgc
ctgacttccgcagtccctgattgtggccagttgccggaggagagcgtcaaggacaatgtg
gaaccagtccctactcagcgtacctgctgtcaggacattgtaaatgacgtcagctctgat
ggctcagaagatccagcagagttcagcagaggtcaggaaggcatgatcaaccttaggatt
ccagatcatcttcagttagctaagagctgtgtatgggaaggagacagctgtgcccattca
gaaacagagatcaacattgtaagttggaatgctcttattttgccacctgtccccgagggc
tgtgctgagaagacaatgtggtctccacctggcattcctttagacagcccgacagaggtc
cttcagcagccccgggaaacctga

DBGET integrated database retrieval system