KEGG   Homo sapiens (human): 5100Help
Entry
5100              CDS       T01001                                 

Gene name
PCDH8, ARCADLIN, PAPC
Definition
(RefSeq) protocadherin 8
  KO
K16499  protocadherin delta 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    5100 (PCDH8)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   5100 (PCDH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2
Motif
Other DBs
NCBI-GeneID: 5100
NCBI-ProteinID: NP_002581
OMIM: 603580
HGNC: 8660
Ensembl: ENSG00000136099
Vega: OTTHUMG00000016979
Pharos: O95206(Tbio)
UniProt: O95206
Position
13q14.3
AA seq 1070 aa AA seqDB search
MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLA
APGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTV
RPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAE
VGRAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVL
DQNDHAPVLVHPAPANGSLEVAVPGRTAKDTVVARVQARDADEGANGELAFELQQQEPRE
AFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGPAA
PASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKE
VRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP
PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHS
FNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGH
SDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEK
VLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANENV
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgtgaggcgttggggcagcccctgccttttccccttgcagctcttcagcctc
tgctgggtgctctcagtggcccagagcaaaacagtccgatacagcaccttcgaggaggat
gcccccggcacggtcatcgggaccctggccgaggacctgcatatgaaagtatcgggtgac
acaagcttccgcctgatgaagcaattcaacagctctctgctccgggtgcgcgaaggcgac
gggcagctgaccgtcggggacgccggcctggaccgcgagcggctgtgtggccaggccccg
cagtgcgtgctggccttcgatgtggtcagcttctcgcaggagcagttccggctggtgcac
gtggaggtagaggtgagggacgtcaacgaccacgcgccgcgcttccccagggcccagatc
ccggtagaggtgtccgagggtgcggcagtgggcacgcgcatccccttggaggtgccggtg
gacgaggacgtgggcgccaacgggctgcagaccgtgcgcctggccgagccgcacagcccc
tttcgcgtggagctgcagacgcgagcggacggcgctcagtgcgcagacctggtgctgctg
caggagctggaccgcgagagccaggccgcctacagcctggagctggtggcccaggacggc
ggccgcccgccgcgctccgccacggctgccctcagcgtgcgcgtcctggatgcgaatgac
cacagcccggccttcccgcagggcgccgtggccgaagtggagctggcggaagacgcgccc
gtgggctccctgcttctcgacctggacgcagccgaccccgacgagggacctaacggcgac
gtggtgttcgcatttggcgcccgcaccccgccggaggcgcgccgcctctttcggcttgac
ccgcgatcaggccgcctcaccctggccgggcccgtggactacgagcgtcaggacacctac
gagctggacgtgcgggcgcaggaccgcggacccgggccccgcgctgccacctgcaaggtc
atcgtgcgcatccgagacgtcaatgacaacgcacccgacatcgccatcaccccgctggcc
gccccaggcgcgccggcaacctcacccttcgccgctgccgccgccgccgctgcactcggg
ggagcggacgctagctcgccggcgggagccgggacgccggaggctggtgccacttcgctg
gtgccggagggggcggcgcgcgagagcctggtggccctggtcagcacctcggacagggac
tcgggcgccaacgggcaagtgcgctgcgccctctatgggcacgagcacttccggctgcag
ccggcctacgcgggcagctacctggtggtgaccgcggcgtcgctggaccgcgaacgcatc
gccgagtacaacttgacgctggtggccgaggatcgcggcgcgcccccgctgcgcacagtg
cggccctacacggtgcgtgtgggcgacgagaacgacaacgcgccgctcttcacgcggccg
gtctatgaggtgtcggtgcgcgagaacaacccgccaggcgcctacctggccacggtggcc
gcccgcgaccgggacctgggccgcaacggccaggtcacctaccggctgctggaggccgag
gtgggccgcgccgggggcgccgtgtccacttatgtctcggtggacccagctaccggagcc
atctacgcgctgcgcagcttcgactatgagacgctgcgccaactcgacgttcgcatccaa
gctagcgacggcggctcccctcagctttccagcagcgccctagtgcaagtgcgcgtgctg
gaccagaacgaccatgcgccagtcctggtgcacccggcgccagccaatggctccctagaa
gtggcggtgcctgggcgcaccgcaaaggacacggttgtggcccgtgtgcaggcccgggat
gcagacgagggagccaacggggagctggcgttcgagctgcagcagcaggagccgcgcgaa
gccttcgccatcggccgccgcacgggggagatactgctcaccggcgacctctcgcaggag
ccacccggtcgcgtgttcagggcgctcctggtcatatccgacggcggccgtcccccgctc
accaccaccgcaactgtcagcttcgtggtaacagcagggggcgggcgtgggccggctgcg
cctgccagtgcaggaagcccggagcgttcccgcccgcctggctctcggctcggggtgtcc
gggtcggtgctgcaatgggacacgccgctgatcgtcatcatcgtgctggccgggagctgc
acgctgctgctggccgccatcatcgccatcgccaccacctgcaaccgccgcaagaaggag
gtgcgcaaagggggggccctccgggaagagcggcccggggcggcgggcggcggagcctcg
gctcccggctccccggaggaggccgcccggggagccgggcccaggcccaacatgttcgac
gtgctcaccttccctggcaccggcaaagcgccctttggcagccccgcggcggacgcgcct
ccgcctgcggtcgccgcggccgaagtgccgggctcagagggcggcagcgccactggggaa
agcgcctgtcacttcgaggggcagcagcggctccgcggcgcgcacgccgagccctacggt
gcctccccgggttttggaaaggagccggcgccccctgtggcggtgtggaaaggacactcc
ttcaacaccatttctggcagagaagcagagaagttcagcggcaaagacagcggtaaaggg
gacagtgatttcaacgacagcgattccgacatcagcggggacgctctgaaaaaggatctc
atcaaccacatgcagagtggactgtgggcgtgcaccgctgagtgtaagatcctgggccac
tctgaccgctgctggagcccatcctgcagcgggcccaacgcacatccatcgcctcaccca
ccagcccagatgtcaaccttctgtaagagcacgtcactgcctcgggatcctctgcgcagg
gacaattactaccaggcccagctgcccaagacagtggggctgcagagcgtctatgagaaa
gtactgcacagagactatgacaggacagtcactctgctctcccctccccgtccagggagg
ctcccagacctgcaggagattggagtacccctctaccagtcccctcctggcaggtacctg
tccccgaagaagggagccaatgaaaatgtgtaa

DBGET integrated database retrieval system