KEGG   Homo sapiens (human): 51001Help
Entry
51001             CDS       T01001                                 

Gene name
MTERF3, CGI-12, MTERFD1
Definition
(RefSeq) mitochondrial transcription termination factor 3
  KO
K15032  mTERF domain-containing protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    51001 (MTERF3)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51001 (MTERF3)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Release factors
   51001 (MTERF3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    51001 (MTERF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: mTERF
Motif
Other DBs
NCBI-GeneID: 51001
NCBI-ProteinID: NP_057026
OMIM: 616930
HGNC: 24258
Ensembl: ENSG00000156469
Vega: OTTHUMG00000164713
Pharos: Q96E29(Tdark)
UniProt: Q96E29
Structure
PDB: 

Position
8q22.1
AA seq 417 aa AA seqDB search
MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKT
YRTSSLWNSSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLS
PMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLL
RLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADV
AQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV
YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLF
KVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtcagcccaacagatacccagatggtttaactcagttaagttgaggagcctc
attaatgctgcacaactcacaaaacgttttactagaccagcaagaacactgttacatggc
ttttctgctcagcctcagatatcctctgacaattgctttctccagtggggatttaagact
tacaggacttcctccttatggaatagttcccagtctactagctcaagtagtcaggagaat
aattctgcccaaagcagtctgcttccttccatgaatgaacagtcacagaagacacaaaat
atatccagctttgattctgagctgtttctagaagaactggatgaattgcctccattgtct
ccaatgcagccaatttcagaggaagaggctattcagattattgcagaccctccattgcca
ccagcttcattcacacttcgagactatgtggatcattctgagactctgcagaagttggtt
cttctaggcgtggatttgtccaagatagaaaaacatccagaagcagcaaacctccttctg
agactggattttgaaaaagacattaagcaaatgcttctgtttcttaaagatgtgggtata
gaggataaccaactgggagcattcctgacaaaaaatcatgcaattttctctgaagacctt
gaaaatctgaagaccagggtggcttatctgcattcaaaaaatttcagtaaagcagatgtt
gcacagatggtcagaaaagcaccatttttgctgaacttttcagtggaaagactggataac
agattgggattttttcagaaagaacttgaacttagtgtgaagaagactagagatctggta
gttcgtctcccaaggctgctaactggaagtctggaacccgtgaaagaaaatatgaaggtt
tatcgtcttgaacttggttttaaacataacgaaattcaacatatgatcaccagaatccca
aagatgttaactgcaaataaaatgaaacttaccgagacgtttgattttgtgcacaatgtg
atgagcattccccaccacatcattgtcaagttcccacaggtatttaatacaaggctgttt
aaggtcaaagaaagacacttgtttcttacctatttaggaagagcacagtatgatccagca
aaacctaactacatctctttggacaaactagtatctattcctgatgaaatattttgtgaa
gagattgccaaagcatcagtacaggactttgaaaaattcttaaaaacgctttag

DBGET integrated database retrieval system