KEGG   Homo sapiens (human): 51003Help
Entry
51003             CDS       T01001                                 

Gene name
MED31, 3110004H13Rik, CGI-125, Soh1
Definition
(RefSeq) mediator complex subunit 31
  KO
K15153  mediator of RNA polymerase II transcription subunit 31
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51003 (MED31)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     51003 (MED31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med31
Motif
Other DBs
NCBI-GeneID: 51003
NCBI-ProteinID: NP_057144
HGNC: 24260
Ensembl: ENSG00000108590
Vega: OTTHUMG00000102051
Pharos: Q9Y3C7(Tdark)
UniProt: Q9Y3C7
Position
17p13.1
AA seq 131 aa AA seqDB search
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKD
PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA
EQQQQNNTSGK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgctgtcgctatggagacagatgatgctggaaatcgacttcggtttcagttg
gagttggaatttgtgcaatgtttagccaacccaaattaccttaattttcttgcccaaaga
ggttacttcaaagacaaagcttttgttaattatcttaaatacttgctttactggaaagac
ccagaatatgccaagtatctaaagtaccctcagtgtttacacatgttagagctgctccaa
tatgaacacttccgaaaggagctggtgaatgctcagtgtgcgaaatttattgatgaacag
cagattctacattggcagcactattcccggaagcggatgcgccttcagcaagccttggca
gagcagcaacagcaaaataacacatcgggaaaatga

DBGET integrated database retrieval system