KEGG   Homo sapiens (human): 51009
Entry
51009             CDS       T01001                                 

Symbol
DERL2, CGI-101, DERtrin-2, F-LAN-1, F-LANa, FLANa, derlin-2
Name
(RefSeq) derlin 2
  KO
K13989  Derlin-2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51009 (DERL2)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 51009
NCBI-ProteinID: NP_057125
OMIM: 610304
HGNC: 17943
Ensembl: ENSG00000072849
Vega: OTTHUMG00000102040
Pharos: Q9GZP9(Tbio)
UniProt: Q9GZP9
Position
17p13.2
AA seq 239 aa
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL
GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH
IYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgtaccagagcttgcggctggagtacctgcagatcccaccggtcagccgcgcctac
accactgcctgcgtcctcaccaccgccgccgtgcagttggaattgatcacaccttttcag
ttgtacttcaatcctgaattaatctttaaacactttcaaatatggagattaatcaccaac
ttcttattttttgggccagttggattcaattttttatttaacatgatttttctatatcgt
tactgtcgaatgctagaagaaggctctttccgaggtcggacagcagactttgtatttatg
ttcctttttggtggattcttaatgaccctttttggtctgtttgtgagcttagttttcttg
ggccaggcctttacaataatgctcgtctatgtgtggagccgaaggaacccctatgtccgc
atgaacttcttcggccttctcaacttccaggccccctttctgccctgggtgctcatggga
ttttccttgttgttggggaactcaatcattgtggaccttttgggtattgcagttggacac
atatattttttcttggaagatgtatttcccaatcaacctggtggaataagaattctgaaa
acaccatctattttgaaagctatttttgatacaccagatgaggatccaaattacaatcca
ctacctgaggaacggccaggaggcttcgcctggggtgagggccagcggcttggaggttaa

KEGG   Homo sapiens (human): 79139
Entry
79139             CDS       T01001                                 

Symbol
DERL1, DER-1, DER1, derlin-1
Name
(RefSeq) derlin 1
  KO
K11519  Derlin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06464  Amyotrophic lateral sclerosis
  Element
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79139 (DERL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    79139 (DERL1)
   05022 Pathways of neurodegeneration - multiple diseases
    79139 (DERL1)
SSDB
Motif
Pfam: DER1 DUF3341
Other DBs
NCBI-GeneID: 79139
NCBI-ProteinID: NP_077271
OMIM: 608813
HGNC: 28454
Ensembl: ENSG00000136986
Vega: OTTHUMG00000165080
Pharos: Q9BUN8(Tbio)
UniProt: Q9BUN8 A0A024R9G3
Position
8q24.13
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF
YFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggagactggttcaggagcatcccggcgatcacgcgctattggttcgcc
gccaccgtcgccgtgcccttggtcggcaaactcggcctcatcagcccggcctacctcttc
ctctggcccgaagccttcctttatcgctttcagatttggaggccaatcactgccaccttt
tatttccctgtgggtccaggaactggatttctttatttggtcaatttatatttcttatat
cagtattctacgcgacttgaaacaggagcttttgatgggaggccagcagactatttattc
atgctcctctttaactggatttgcatcgtgattactggcttagcaatggatatgcagttg
ctgatgattcctctgatcatgtcagtactttatgtctgggcccagctgaacagagacatg
attgtatcattttggtttggaacacgatttaaggcctgctatttaccctgggttatcctt
ggattcaactatatcatcggaggctcggtaatcaatgagcttattggaaatctggttgga
catctttattttttcctaatgttcagatacccaatggacttgggaggaagaaattttcta
tccacacctcagtttttgtaccgctggctgcccagtaggagaggaggagtatcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggcggaggcgggagacac
aactggggccagggctttcgacttggagaccagtga

KEGG   Homo sapiens (human): 91319
Entry
91319             CDS       T01001                                 

Symbol
DERL3, C22orf14, IZP6, LLN2, derlin-3
Name
(RefSeq) derlin 3
  KO
K13989  Derlin-2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    91319 (DERL3)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 91319
NCBI-ProteinID: NP_001002862
OMIM: 610305
HGNC: 14236
Ensembl: ENSG00000099958
Vega: OTTHUMG00000150743
Pharos: Q96Q80(Tbio)
UniProt: Q96Q80
Position
22q11.23
AA seq 235 aa
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcgtggcagggactagcggccgagttcctgcaggtgccggcggtgacgcgggcttac
accgcagcctgtgtcctcaccaccgccgcggtgcagctggagctcctcagcccctttcaa
ctctacttcaacccgcaccttgtgttccggaagttccaggtctggaggctcgtcaccaac
ttcctcttcttcgggcccctgggattcagcttcttcttcaacatgctcttcgtgttccgc
tactgccgcatgctggaagagggctccttccgcggccgcacggccgacttcgtcttcatg
tttctcttcgggggcgtccttatgaccctgctgggactcctgggcagcctgttcttcctg
ggccaggccctcatggccatgctggtgtacgtgtggagccgccgcagccctcgggtgagg
gtcaacttcttcggcctgctcactttccaggcaccgttcctgccttgggcgctcatgggc
ttctcgctgctgctgggcaactccatcctcgtggacctgctggggattgcggtgggccat
atctactacttcctggaggacgtcttccccaaccagcctggaggcaagaggctcctgcag
acccctggcttcctaaagctgctcctggatgcccctgcagaagaccccaattacctgccc
ctccctgaggaacagccaggaccccatctgccacccccgcagcagtga

DBGET integrated database retrieval system