KEGG   Homo sapiens (human): 51014Help
Entry
51014             CDS       T01001                                 

Gene name
TMED7, CGI-109, p24g3, p24gamma3, p27
Definition
(RefSeq) transmembrane p24 trafficking protein 7
  KO
K20349  p24 family protein gamma-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51014 (TMED7)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    51014 (TMED7)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    51014 (TMED7)
Transporters [BR:hsa02000]
 Other transporters
  Others
   51014 (TMED7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 51014
NCBI-ProteinID: NP_861974
HGNC: 24253
Ensembl: ENSG00000134970
Vega: OTTHUMG00000132013
Pharos: Q9Y3B3(Tdark)
UniProt: Q9Y3B3
Position
5q22.3
AA seq 224 aa AA seqDB search
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggccggggtccgcgcagcgctgggcggccgtcgcgggccgttgggggtgcagg
ctgctcgcactgctgctactggtgcctggacccggcggcgcctctgagatcaccttcgag
cttcctgacaacgccaagcagtgcttctacgaggacatcgctcagggcaccaagtgcacc
ctggagttccaggtgattactggtggtcactatgatgtagattgtcgattagaagatcct
gatggtaaagtgttatacaaagagatgaagaaacagtatgatagttttaccttcacagcc
tccaaaaatgggacatacaaattttgcttcagcaatgaattttctactttcacacataaa
actgtatattttgattttcaagttggagaagacccacctttgtttcctagtgagaaccga
gtcagtgctcttacccagatggaatctgcctgtgtttcaattcacgaagctctgaagtct
gtcatcgattatcagactcatttccgtttaagagaagctcaaggccgaagccgagcagag
gatctaaatacaagagtggcctattggtcagtaggagaagccctcattcttctggtggtt
agcatagggcaggtatttcttttgaaaagctttttctcagataaaagaaccaccacaact
cgtgttggatcataa

DBGET integrated database retrieval system