KEGG   Homo sapiens (human): 51022Help
Entry
51022             CDS       T01001                                 

Gene name
GLRX2, CGI-133, GRX2
Definition
(RefSeq) glutaredoxin 2
  KO
K03676  glutaredoxin 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51022 (GLRX2)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   51022 (GLRX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaredoxin Thioredoxin_3 DUF836 Thioredoxin_2 DUF799
Motif
Other DBs
NCBI-GeneID: 51022
NCBI-ProteinID: NP_932066
OMIM: 606820
HGNC: 16065
Ensembl: ENSG00000023572
Vega: OTTHUMG00000035677
Pharos: Q9NS18(Tbio)
UniProt: Q9NS18
Structure
PDB: 

Position
1q31.2
AA seq 164 aa AA seqDB search
MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQI
QETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERT
VPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatttggcgccgcgcggcgctggcggggacgcggctggtttggagcaggagcggctcg
gcaggctggcttgacagggcggcgggagctgcgggagctgcggcagctgcggcctctggg
atggagagcaatacatcatcatctttggagaatttagcgacggcgcctgtgaaccagatc
caagaaacaatttctgataattgtgtggtgattttctcaaaaacatcctgttcttactgt
acaatggcaaaaaagcttttccatgacatgaatgttaactataaagtggtggaactggac
ctgcttgaatatggaaaccagttccaagatgctctttacaaaatgactggtgaaagaact
gttccaagaatatttgtcaatggtacttttattggaggtgcaactgacactcataggctt
cacaaagaaggaaaattgctcccactagttcatcagtgttatttaaaaaaaagtaagagg
aaagaatttcagtga

DBGET integrated database retrieval system