KEGG   Homo sapiens (human): 51023Help
Entry
51023             CDS       T01001                                 

Gene name
MRPS18C, CGI-134, MRP-S18-1, MRP-S18-c, MRPS18-1, S18mt-c, mrps18-c
Definition
(RefSeq) mitochondrial ribosomal protein S18C
  KO
K02963  small subunit ribosomal protein S18
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51023 (MRPS18C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51023 (MRPS18C)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    51023 (MRPS18C)
  Bacteria
    51023 (MRPS18C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 Cript
Motif
Other DBs
NCBI-GeneID: 51023
NCBI-ProteinID: NP_057151
OMIM: 611983
HGNC: 16633
Ensembl: ENSG00000163319
Vega: OTTHUMG00000130430
Pharos: Q9Y3D5(Tdark)
UniProt: Q9Y3D5 A0A024RDH9
Position
4q21.23
AA seq 142 aa AA seqDB search
MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKE
PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM
PVTYKDPAYLKDPKVCNIRYRE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgtggttgctgtttgcggtggtctagggaggaagaagttgacacacttggta
acggctgctgtcagccttacacatcccgggactcacacggtgctttggagaagaggttgt
tcacaacaggtatccagcaatgaggacctgcccatttcaatggaaaatccttataaagaa
cctcttaagaaatgtatcttgtgtggaaagcatgtagattataagaatgtacagcttttg
tcccagtttgtttctccatttactggatgcatttatggaaggcacattacaggtctttgt
gggaagaaacagaaagaaatcacaaaagcaattaagagagctcaaataatggggtttatg
ccagttacatacaaggatcctgcatatctcaaggaccctaaagtttgtaacatcagatat
cgggaataa

DBGET integrated database retrieval system