KEGG   Homo sapiens (human): 51025Help
Entry
51025             CDS       T01001                                 

Gene name
PAM16, CGI-136, MAGMAS, SMDMDM, TIM16, TIMM16
Definition
(RefSeq) presequence translocase associated motor 16
  KO
K17805  mitochondrial import inner membrane translocase subunit TIM16
Organism
hsa  Homo sapiens (human)
Disease
H01830  Spondylometaphyseal dysplasia, Megarbane-Dagher-Melki type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51025 (PAM16)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    51025 (PAM16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pam16
Motif
Other DBs
NCBI-GeneID: 51025
NCBI-ProteinID: NP_057153
OMIM: 614336
HGNC: 29679
Ensembl: ENSG00000217930
Vega: OTTHUMG00000129466
Pharos: Q9Y3D7(Tbio)
UniProt: Q9Y3D7
Position
16p13.3
AA seq 125 aa AA seqDB search
MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQ
QILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKG
QMPHT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtacctggcccagatcattgtgatgggcgtgcaggtggtgggcagggccttt
gcacgggccttgcggcaggagtttgcagccagccgggccgcagctgatgcccgaggacgc
gctggacaccggtctgcagccgcttccaacctctccggcctcagcctccaggaggcacag
cagattctcaacgtgtccaagctgagccctgaggaggtccagaagaactatgaacactta
tttaaggtgaatgataaatccgtgggtggctccttctacctgcagtcaaaggtggtccgc
gcaaaggagcgcctggatgaggaactcaaaatccaggcccaggaggacagagaaaaaggg
cagatgccccatacgtga

DBGET integrated database retrieval system