KEGG   Homo sapiens (human): 51026
Entry
51026             CDS       T01001                                 

Gene name
GOLT1B, CGI-141, GCT2, GOT1, GOT1B, YMR292W
Definition
(RefSeq) golgi transport 1B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Got1
Other DBs
NCBI-GeneID: 51026
NCBI-ProteinID: NP_057156
OMIM: 615078
HGNC: 20175
Ensembl: ENSG00000111711
Vega: OTTHUMG00000169133
Pharos: Q9Y3E0(Tdark)
UniProt: Q9Y3E0
Position
12p12.1
AA seq 138 aa
MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF
QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN
LPGIRSFVDKVGESNNMV
NT seq 417 nt   +upstreamnt  +downstreamnt
atgatctccttaacggacacgcagaaaattggaatgggattaacaggatttggagtgttt
ttcctgttctttggaatgattctcttttttgacaaagcactactggctattggaaatgtt
ttatttgtagccggcttggcttttgtaattggtttagaaagaacattcagattcttcttc
caaaaacataaaatgaaagctacaggtttttttctgggtggtgtatttgtagtccttatt
ggttggcctttgataggcatgatcttcgaaatttatggattttttctcttgttcaggggc
ttctttcctgtcgttgttggctttattagaagagtgccagtccttggatccctcctaaat
ttacctggaattagatcatttgtagataaagttggagaaagcaacaatatggtataa

DBGET integrated database retrieval system