KEGG   Homo sapiens (human): 51031
Entry
51031             CDS       T01001                                 

Gene name
GLOD4, C17orf25, CGI-150, HC71
Definition
(RefSeq) glyoxalase domain containing 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glyoxalase CppA_N Glyoxalase_4
Other DBs
NCBI-GeneID: 51031
NCBI-ProteinID: NP_057164
HGNC: 14111
Ensembl: ENSG00000167699
Vega: OTTHUMG00000177497
Pharos: Q9HC38(Tdark)
UniProt: Q9HC38
Structure
PDB: 
3ZI1

Position
17p13.3
AA seq 298 aa
MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGF
GPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAP
GGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADN
QCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATV
QVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
NT seq 897 nt   +upstreamnt  +downstreamnt
atggctgctcgcagagctctgcacttcgtattcaaagtgggaaaccgcttccagacggcg
cgtttctatcgggacgtcctggggatgaaggttctgcggcatgaggaatttgaagaaggc
tgcaaagctgcctgtaatgggccttatgatgggaaatggagtaaaacaatggtgggattt
gggcctgaggatgatcattttgtcgcagaactgacttacaattatggcgtcggagactac
aagcttggcaatgactttatgggaatcacgctcgcttctagccaggctgtcagcaacgcc
aggaagctggagtggccactgacggaagttgcagaaggtgtttttgaaaccgaggccccg
ggaggatataagttctatttgcagaatcgcagtctgcctcagtcagatcctgtattaaaa
gtaactctagcagtgtctgatcttcaaaagtccttgaactactggtgtaatctactggga
atgaaaatttatgaaaaagatgaagaaaagcaaagggctttgctgggctatgctgataac
cagtgtaagctggagctacagggcgtcaagggtggggtggaccatgcagcagcttttgga
agaattgccttctcttgcccccagaaagagttgccagacttagaagacttgatgaaaagg
gagaaccagaagattctgactcccctggtgagcctggacaccccagggaaagcaacagta
caggtggtcattctggccgaccctgacggacatgaaatttgctttgtcggggatgaagca
tttcgagaactttctaagatggatccagagggaagcaaattgttggatgatgcaatggca
gcagataaaagtgacgagtggtttgccaaacacaataaacccaaagcttcaggttaa

DBGET integrated database retrieval system