KEGG   Homo sapiens (human): 5104Help
Entry
5104              CDS       T01001                                 

Gene name
SERPINA5, PAI-3, PAI3, PCI, PCI-B, PLANH3, PROCI
Definition
(RefSeq) serpin family A member 5
  KO
K03913  protein C inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5104 (SERPINA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   5104 (SERPINA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 5104
NCBI-ProteinID: NP_000615
OMIM: 601841
HGNC: 8723
Ensembl: ENSG00000188488
Vega: OTTHUMG00000170860
Pharos: P05154(Tbio)
UniProt: P05154 A0A024R6N9 B4DDH1
Structure
PDB: 

Position
14q32.13
AA seq 406 aa AA seqDB search
MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAA
PSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQ
PRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQT
KGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSRED
QYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLE
LYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGT
RAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcttcctcctcttgtgcctggtgcttctcagccctcagggggcctcccttcac
cgccaccacccccgggagatgaagaagagagtcgaggacctccatgtaggtgccacggtg
gcccccagcagcagaagggactttacctttgacctctacagggccttggcttccgctgcc
cccagccagagcatcttcttctcccctgtgagcatctccatgagcctggccatgctctcc
ctgggggctgggtccagcacaaagatgcagatcctggagggcctgggcctcaacctccag
aaaagctcagagaaggagctgcacagaggctttcagcagctccttcaggaactcaaccag
cccagagatggcttccagctgagcctcggcaatgcccttttcaccgacctggtggtagac
ctgcaggacaccttcgtaagtgccatgaagacgctgtacctggcagacactttccctacc
aactttagggactctgcaggggccatgaagcagatcaatgattatgtggcaaagcaaacg
aagggcaagattgtggacttgcttaagaacctcgatagcaatgcggtcgtgatcatggtg
aattacatcttctttaaagctaagtgggagacaagcttcaaccacaaaggcacccaagag
caagacttctacgtgacctcggagactgtggtgcgggtacccatgatgagccgcgaggat
cagtatcactacctcctggaccggaacctctcctgcagggtggtgggggtcccctaccaa
ggcaatgccacggctttgttcattctccccagtgagggaaagatgcagcaggtggagaat
ggactgagtgagaaaacgctgaggaagtggcttaagatgttcaaaaagaggcagctcgag
ctttaccttcccaaattctccattgagggctcctatcagctggagaaagtcctccccagt
ctggggatcagtaacgtcttcacctcccatgctgatctgtccggcatcagcaaccactca
aatatccaggtgtctgagatggtgcacaaagctgtggtggaggtggacgagtcgggaacc
agagcagcggcagccacggggacaatattcactttcaggtcggcccgcctgaactctcag
aggctagtgttcaacaggccctttctgatgttcattgtggataacaacatcctcttcctt
ggcaaagtgaaccgcccctga

DBGET integrated database retrieval system