KEGG   Homo sapiens (human): 51053
Entry
51053             CDS       T01001                                 
Symbol
GMNN, Gem, MGORS6
Name
(RefSeq) geminin DNA replication inhibitor
  KO
K10749  geminin
Organism
hsa  Homo sapiens (human)
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    51053 (GMNN)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    51053 (GMNN)
SSDB
Motif
Pfam: Geminin Fmp27_WPPW DLP_helical Csm1_N HAUS2 GPS2_interact Aldedh DivIC PhoU UPF0242
Other DBs
NCBI-GeneID: 51053
NCBI-ProteinID: NP_001238918
OMIM: 602842
HGNC: 17493
Ensembl: ENSG00000112312
Pharos: O75496(Tbio)
UniProt: O75496 A0A024QZY7
Structure
Position
6:24774937..24786099
AA seq 209 aa
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL
HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET
VEDSLVEDSEIGTCAEGTVSSSTDAKPCI
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaatcccagtatgaagcagaaacaagaagaaatcaaagagaatataaagaatagttct
gtcccaagaagaactctgaagatgattcagccttctgcatctggatctcttgttggaaga
gaaaatgagctgtccgcaggcttgtccaaaaggaaacatcggaatgaccacttaacatct
acaacttccagccctggggttattgtcccagaatctagtgaaaataaaaatcttggagga
gtcacccaggagtcatttgatcttatgattaaagaaaatccatcctctcagtattggaag
gaagtggcagaaaaacggagaaaggcgctgtatgaagcacttaaggaaaatgagaaactt
cataaagaaattgaacaaaaggacaatgaaattgcccgcctgaaaaaggagaataaagaa
ctggcagaagtagcagaacatgtacagtatatggcagagctaatagagagactgaatggt
gaacctctggataattttgaatcactggataatcaggaatttgattctgaagaagaaact
gttgaggattctctagtggaagactcagaaattggcacgtgtgctgaaggaactgtatct
tcctctacggatgcaaagccatgtatatga

DBGET integrated database retrieval system