KEGG   Homo sapiens (human): 51059Help
Entry
51059             CDS       T01001                                 

Gene name
FAM135B, C8ORFK32
Definition
(RefSeq) family with sequence similarity 135 member B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF676 DUF3657 Palm_thioest PGAP1 LCAT
Motif
Other DBs
NCBI-GeneID: 51059
NCBI-ProteinID: NP_056996
HGNC: 28029
Ensembl: ENSG00000147724
Vega: OTTHUMG00000149864
Pharos: Q49AJ0(Tdark)
UniProt: Q49AJ0
Position
8q24.23
AA seq 1406 aa AA seqDB search
MSEIQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIAGQTESSSLHSA
CVHDSTVHSRVFQILYRNEEVPINDAVVFRVHLLLGGERMEDALSEVDFQLKVDLHFTDS
EQQLRDVAGAPMVSSRTLGLHFHPRNGLHHQVPVMFDYFHLSVISVTVHAALVALQQPLI
SFTRPGRGSWLGKGGPDTGQEQSIISLENLVFGAGYCKPTSSEGSFYITSENCMQHAHKW
HRDLCLLLLHAYRGLRLHFLVIMRDIPELPHTELEALAVEETLSQLCSELQMLNNPEKIA
EQISKDLAWLTSHMMTLWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYMEHQKLA
VLTFQENLIQTHSQLSLDIRNSEYLTSMPPLPAECLDIDGDWNTLPVIFEDRYVDCPATG
HNLSVYPNFDVPVTSPTIMNLKDKEDNCMVNSNLSFREDLVLSTIKPSQMDSDEEVIRCP
EPGENVATQNHMDMCSESQVYISIGEFQNKAGVPEDECWTGQTSDAGTYPVADVDTSRRS
PGPEDGQAPVLTYIDVKSSNKNPSRAEPLVAFNAQHESRSSRDKYGLDRTGLSKVVVGGS
HQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSEPCDPLSSTLREPLDIRSSLKD
SHTEEQEELSVLSGVIKRSSSIISDSGIESEPSSVAWSEARSRALELPSDREVLHPFVRR
HALHRNSLEGGHTESNTSLPSGIQASLTSISSLPFEEDEREVALTKLTKSVSAPHISSPE
EAAEDADTKQQDGGFAEPSDMHSKSQGSPGSCSQLCGDSGTDAGADHPLVEIVLDADNQQ
GPGYIDIPKGKGKQFDAQGHCLPDGRTENTPGVETKGLNLKIPRVIALENPRTRSLHRAL
EETPKGMPKDLNVGQQALSNSGISEVEGLSQHQVPELSCTSAADAINRNSTGQQSQSGSP
CIMDDTAFNRGVNAFPEAKHKAGTVCPTVTHSVHSQVLKNQELKAGTSIMGSHLTSAETF
TLDSLKAVEVVNLSVSCTATCLPFSSVPKETPARAGFSSKQTLFPITHQPLGSFGVVSTH
SSTLDEEVSERMFSFYQAKEKFKKELKIEGFLYSDLTVLASDIPYFPPEEEEENLEDGIH
LVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQMDTFADFDTMTDRLLDEIIQ
HIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTL
VSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVP
FHSARIEMCKTALKDRHTGPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGR
AAHIAVLDSELFLEKFFLVAGLNYFK
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaatacaaggaacggttgagttttcggtagagctacataaattttataatgtg
gatctctttcagagagggtattaccagatccgagtgaccttgaaggtgtcttcaaggatc
ccccacagactgagtgcctccatcgctgggcagacagagagcagcagcctgcattcagcc
tgtgtccatgacagcaccgtgcacagccgggtctttcagatcttataccggaatgaagag
gtacccataaatgatgctgtggtcttccgagttcatttactcttgggtggtgaaaggatg
gaagacgcactgagtgaagtagattttcaactcaaggtggatctgcactttacggacagt
gaacagcagttgagggatgtggctggggcaccgatggtcagcagccgaacgcttggcctg
cacttccacccccggaatggtctgcaccaccaggtcccggtcatgttcgactatttccac
ctgtctgtgatctcggtgaccgtccatgctgccctggtggctctgcagcagccattgatc
agttttactcgtccaggaagaggctcctggcttggtaaaggtggcccagacaccggacaa
gaacagtctatcatttctctggaaaacttggtctttggagctgggtactgcaagccgact
tcctcagagggaagcttctacatcacctctgagaactgcatgcagcacgcacacaagtgg
caccgagacctgtgcctgttgctcctccacgcttaccggggtctccgtctccacttcctg
gtgatcatgcgggacatcccagagctgccacacacggagctggaggcccttgctgttgaa
gaaacactttctcagctgtgctcagagctacagatgttgaacaatccagagaagatcgct
gagcagataagcaaggatctggcctggctcacgtcccacatgatgactctgtggacccag
ttcctggacacagtcactctgcactcccaagtgaccacttatctcacccaggaacaccac
accctgagggtccgaaggttttctgaggccttcttttacatggagcaccaaaaacttgca
gtcctgacatttcaggagaatctgatacagacgcacagccagctgtccctggatatccgg
aactcggagtacctcactagcatgcccccgctgcctgcagagtgcctggacatcgacggc
gattggaacaccctgccggtgatctttgaggacagatacgtggactgccctgcgacaggg
cataacttgagtgtttatcctaattttgatgttccagtgacaagtcctacaataatgaat
ctgaaagacaaggaagataactgtatggtaaatagcaatttatcttttagggaagacctt
gtcttgtctaccataaaaccatcccaaatggattctgatgaagaagttataaggtgtcca
gagccaggtgagaatgtggccacacaaaatcatatggacatgtgctctgaatctcaggtg
tatatatcaattggtgaatttcaaaacaaagcaggtgtgcctgaagatgaatgttggact
ggccaaacatctgatgctgggacatatccagtggcagatgtggatacttctagaaggagt
ccaggtccagaggatggacaggccccagtgctgacctacattgacgtaaaatctagcaat
aagaacccctccagagctgaacccctggtggccttcaatgctcagcatgagagtaggagc
tctagagataagtatggattagacaggactgggctaagcaaagtggtagtaggtggaagc
caccaaaatgccatctcttcagacaaaacaactctccatgaattaagtactctaggaaag
ggaatagatcaagaggggaagatggtgctgctaagcttgaaactcaccccctctgagccc
tgtgatccactaagttctaccctgagggagcccttagatattaggtcttccctaaaggac
tctcacacagaagagcaggaggaactctcagtgctatccggggtcatcaagagatcttca
tccatcatatctgattcaggcattgagagtgagccaagctccgtcgcctggtcagaggcc
cgaagcagggctctggagttgcccagtgatcgggaagtcttgcacccgtttgttcgaaga
catgccctccaccggaactccctagagggtggacacacagaaagtaacacaagtttgcca
agcggcatccaggcttctctcacctccattagctctttaccttttgaggaggatgagcgg
gaggtggcactcactaagttaaccaagtctgtatctgctccccacatcagtagcccagag
gaggctgctgaagatgcggacaccaagcagcaagatggaggttttgctgaaccttcagat
atgcacagcaagagccaaggttccccaggatcttgctctcaactttgtggtgactctgga
acagatgctggagcagaccatcccctggtggagatagttttagatgctgacaaccagcag
ggccccggatacatagacatccccaaagggaaagggaagcagtttgatgctcaaggacac
tgtcttcctgatggcaggactgagaacactccaggtgttgaaaccaaaggtcttaattta
aaaataccacgcgtcatagcacttgaaaaccccaggaccagatctcttcatagagcactt
gaggaaaccccaaagggcatgcctaaagacttgaatgtgggtcagcaagctctttccaac
agtggcatctcagaggttgagggtctctctcaacatcaggtgcctgaattgagctgtacg
tcagctgctgatgccatcaacaggaactcaacaggccagcaaagccaaagcggttcacct
tgcattatggatgacacagcatttaatagaggagtgaatgccttcccggaggctaaacat
aaagcaggcactgtgtgccccactgtgacccattccgttcattcccaggttttgaaaaac
caagagctgaaggcaggcacttccatcatggggtcccatctgacttctgcagagaccttt
actctggacagcctgaaggctgtggaggttgtgaacttatctgtgtcttgcactgccacc
tgtctccctttctcatctgtgcccaaggagacccctgccagggctggattctcttccaaa
cagaccctgtttcccatcacccatcagcctttgggatcctttggagttgtttctacccat
tccagcacgttggatgaggaagtcagtgagaggatgtttagtttttatcaggccaaagaa
aaatttaaaaaagaactgaagattgaaggatttctgtacagtgacttaactgtactagct
tctgatataccatatttcccaccagaggaagaggaagaaaatttggaagatggaattcac
ctggttgtctgtgtccatggcctggatgggaacagtgcagacctccggctggtaaagact
ttcatagaactggggctccctggaggaaaactggacttcctaatgtctgaaaagaatcag
atggacacatttgcagattttgatactatgacggatcggttattggatgaaatcattcaa
cacattcagttgtacaacctctccatatcccgaattagcttcattggccattctcttggc
aacatcatcatccgatcggtcctcacacggccccggttccggtattacctcaacaaactc
cacacgttcctgtcactctctgggcctcacctgggaaccctgtacaacaacagcaccctg
gttagtacaggcttatggctcatgcagaaactgaagaaatccgggtctctactgcagctg
accttcagggataatgctgatttgcgcaaatgtttcctctaccaactaagccaaaaaaca
gggctgcagtattttaaaaacgtcgtgctggttgcttctccccaagaccgttatgtgcca
tttcattcagccaggattgaaatgtgtaaaactgccctcaaagacagacacacagggcca
gtttatgcagaaatgatcaacaacctcctgggccctctggttgaagccaaggactgcact
ttaatccgacacaacgtgttccacgccctgcccaacactgccaacaccctgatcggccga
gccgctcacatcgctgtgctggattcagaactcttcctggagaagtttttcttggtggca
ggactcaactacttcaagtag

DBGET integrated database retrieval system