KEGG   Homo sapiens (human): 51061Help
Entry
51061             CDS       T01001                                 

Gene name
TXNDC11, EFP1
Definition
(RefSeq) thioredoxin domain containing 11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 ATG16 Thioredoxin_7 Macoilin KASH_CCD Thioredoxin_8 DUF4201 Leu_zip APG6 SHE3 ABC_membrane_2 DUF836 HOOK PRKG1_interact DUF3450 DUF812 FPP TMF_TATA_bd Cnn_1N GAS TBCA Pinin_SDK_memA IncA
Motif
Other DBs
NCBI-GeneID: 51061
NCBI-ProteinID: NP_001290376
OMIM: 617792
HGNC: 28030
Ensembl: ENSG00000153066
Vega: OTTHUMG00000177467
Pharos: Q6PKC3(Tdark)
UniProt: Q6PKC3
Position
16p13.13
AA seq 985 aa AA seqDB search
MSECGGRGGGSSSSEDAEDEGGGGGGPAGSDCLSSSPTLATASSAGRLRRGLRGAFLMAR
QRPELLCGAVALGCALLLALKFTCSRAKDVIIPAKPPVSFFSLRSPVLDLFQGQLDYAEY
VRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVLFVAINCWWNQGKCRKQKHFFY
FPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGYF
EFSGSPQPPGYLTFFTSALHSLKKALESTSSPRALVSFTGEWHLETKIYVLDYLGTVRFG
VITNKHLAKLVSLVHSGSVYLHRHFNTSLVFPREVLNYTAENICKWALENQETLFRWLRP
HGGKSLLLNNELKKGPALFLFIPFNPLAESHPLIDEITEVALEYNNCHGDQVVERLLQHL
RRVDAPVLESLALEVPAQLPDPPTITASPCCNTVVLPQWHSFSRTHNVCELCVNQTSGGM
KPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSNFLTSYSPFSYYTACCRTIS
RGVSGFIDSEQGVFEAPTVAFSSLEKKCEVDAPSSVPHIEENRYLFPEVDMTSTNFTGLS
CRTNKTLNIYLLDSNLFWLYAERLGAPSSTQVKEFAAIVDVKEESHYILDPKQALMKLTL
ESFIQNFSVLYSPLKRHLIGSGSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCG
FCPSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYP
EDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQSEAVLQRGHISHLEREIQKLRAE
ISSLQRAQVQVESQLSSARRDEHRLRQQQRALEEQHSLLHAHSEQLQALYEQKTRELQEL
ARKLQELADASENLLTENTWLKILVATMERKLEGRDGAESLAAQREVHPKQPEPSATPQL
PGSSPPPANVSATLVSERNKENRTD
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaatgcggaggccgcggcggcggcagcagcagcagcgaggacgccgaggacgag
ggagggggcggcggcggccccgcgggctcagactgcctcagctcgagcccgaccctggcc
acagcgtcctcggcgggccggctccgtcgcgggctgcgtggcgccttcctcatggcgcgc
cagcggccggagctgctctgcggggccgtggcgctcggctgcgcgctgctcctcgccctc
aagttcacctgcagtcgagcaaaagatgtgataataccagcaaagccacctgtcagcttt
ttctccttgaggtctccagtccttgacctcttccaggggcagctggattatgcagagtac
gttcgacgggattcagaggtggtactgctcttcttctatgccccttggtgtggacagtcc
atcgctgccagggcagaaattgagcaagcagcaagtcggctttcagatcaggtgttgttt
gtggcaattaactgttggtggaaccaggggaaatgcagaaaacagaaacacttcttttat
tttcctgtaatatatctgtatcatcggagttttggaccaatcgaatacaaaggccccatg
agtgctgtttacattgagaagtttgtccgccgggtgatgaaaccacttctctacatccca
tctcaatcagaattactagattttctctcaaactacgagcctggagtactcgggtacttt
gagttcagtggctcaccccagcctcctggttatttgaccttcttcacctcagcattacat
tcattaaagaaagctctggaatcaacctcttctccaagggccctggtttcttttactgga
gaatggcatttagaaaccaagatctacgtgctagattacctaggaacagtacgatttggg
gttatcacaaataaacatcttgcgaaactggtatccttagtacactctggaagtgtgtat
ttacatagacatttcaacacatcacttgtcttccccagggaggtcctgaactacacagct
gagaacatctgtaagtgggccttagaaaaccaggagacgctctttcggtggctgcggcca
cacggaggcaagagtctcctgctgaataacgagctgaagaaaggaccagcgctgtttctg
ttcataccttttaatcccctggccgaaagtcatcctttaatagacgagatcaccgaagtg
gccttggagtacaacaactgtcatggggaccaggtggtggagcgtctccttcagcacctg
cggcgggtggatgctccagtgctggagtccctggccctggaagtgccggcacagctgcca
gacccgccaacgatcacagcgtccccctgctgcaacactgtggtgctgccccagtggcac
tccttctccaggacccacaacgtctgtgaactctgtgtcaaccagacctccgggggcatg
aagccgagctcggtcagcgtgccacagtgcagcttttttgaaatggcagcagctctggat
tctttctacctcaaggagcagaccttttatcatgtggcatcagacagcatagaatgcagc
aattttttaacttcctatagccccttcagctactacactgcatgttgcaggaccataagc
aggggtgtgtcaggcttcatcgactctgaacaaggtgtctttgaagcccctactgttgca
ttttcttcccttgagaagaaatgtgaggttgatgccccaagctccgttcctcacattgag
gagaacaggtatctctttccagaagtggacatgactagcacaaacttcacaggcctgagc
tgcagaaccaacaagactctcaacatctaccttttggattcaaatttgttttggttatat
gcagagagactgggtgctccgagctccactcaggtgaaagaatttgcggcaattgttgac
gtgaaagaagaatctcattacatcttggatccaaagcaagcactgatgaagctcacccta
gagtcttttattcaaaacttcagcgttctctatagtcccttgaaaaggcatctcattgga
agtggctctgcccagttcccgtctcagcatttaatcactgaagtgacaactgataccttt
tgggaagtagtccttcaaaaacaggacgttctcctgctctattacgctccgtggtgcggc
ttctgtccatccctcaatcacatcttcatccagctagctcggaacctgcccatggacaca
ttcactgtggcaaggattgacgtgtctcagaatgaccttccttgggaatttatggtcgat
cgtcttcctactgtcttgttttttccctgcaacagaaaggacctaagtgtgaaatacccc
gaagacgtccccatcacccttccaaacctgttgaggttcattttgcatcactcagaccct
gcttccagcccccagaatgtggctaactctcctaccaaggagtgtcttcagagcgaggca
gtcttacagcgggggcacatctcccacttggagagagagatccagaaactgagagcagaa
ataagcagcctccagcgagcacaagtgcaggtggagtcccagctctccagtgcccgcaga
gatgagcaccggctgcggcagcagcagcgggccctggaagagcagcacagcctgctccac
gcacacagtgagcagctgcaggccctctatgagcagaagacacgtgagctgcaggagctg
gcccgcaagctgcaggagctggccgatgcctcagaaaacctccttaccgagaacacgtgg
ctcaagatcctggtggcgaccatggagaggaaactggagggcagggatggagctgaaagc
ctggcggcccagagagaggtccaccccaagcagcctgagccctcagccaccccccagctc
cctggcagctcccctccacctgccaatgtcagcgccacactggtgtctgaaaggaataag
gagaacaggacagactaa

DBGET integrated database retrieval system