KEGG   Homo sapiens (human): 51065
Entry
51065             CDS       T01001                                 

Gene name
RPS27L
Definition
(RefSeq) ribosomal protein S27 like
  KO
K02978  small subunit ribosomal protein S27e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51065 (RPS27L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51065 (RPS27L)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    51065 (RPS27L)
  Archaea
    51065 (RPS27L)
SSDB
Motif
Pfam: Ribosomal_S27e DUF3795
Other DBs
NCBI-GeneID: 51065
NCBI-ProteinID: NP_057004
OMIM: 612055
HGNC: 18476
Ensembl: ENSG00000185088
Vega: OTTHUMG00000155301
Pharos: Q71UM5(Tbio)
UniProt: Q71UM5
Position
15q22.2
AA seq 84 aa
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCS
TVLCQPTGGKARLTEGCSFRRKQH
NT seq 255 nt   +upstreamnt  +downstreamnt
atgcctttggctagagatttactacatccgtccttggaagaggaaaagaaaaaacataaa
aagaaacgcctagtacaaagtccaaattcttactttatggatgtaaaatgtccaggttgc
tacaagatcaccacggttttcagccatgctcagacagtggttctttgtgtaggttgttca
acagtgttgtgccagcctacaggaggaaaggccagactcacagaagggtgttcatttaga
agaaagcaacactaa

DBGET integrated database retrieval system