KEGG   Homo sapiens (human): 51071
Entry
51071             CDS       T01001                                 

Gene name
DERA, CGI-26, DEOC
Definition
(RefSeq) deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    51071 (DERA)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     51071 (DERA)
SSDB
Motif
Pfam: DeoC Sin3_corepress
Other DBs
NCBI-GeneID: 51071
NCBI-ProteinID: NP_057038
HGNC: 24269
Ensembl: ENSG00000023697
Vega: OTTHUMG00000165537
Pharos: Q9Y315(Tbio)
UniProt: Q9Y315
Position
12p12.3
AA seq 318 aa
MSAHNRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLS
GDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNI
PVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK
ACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQ
IYHHVTGRYAAYHDLPMS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtccgcgcacaatcggggcaccgagctcgaccttagctggatctccaaaatacaagtg
aatcacccggcagttctgaggcgtgcggaacaaatccaggctcgcagaaccgtgaaaaag
gagtggcaggctgcttggctcctgaaagctgttacctttatagatcttactacactttca
ggtgatgatacatcttccaacattcaaaggctctgttataaagccaaatacccaatccgg
gaagatctcttaaaagctttaaatatgcatgataaaggcattactacagccgccgtttgt
gtttatcccgcccgggtgtgtgatgctgtaaaagcactcaaggctgcaggctgtaatatc
cctgtggcatcagtggccgctggatttccagctggacagactcatttgaagacacgatta
gaagagatcagattggctgtggaagatggagctacagaaatcgacgtggtaattaacaga
agcttggtgctgacaggccagtgggaagccctgtatgatgagattcgtcagtttcgcaag
gcctgtggggaggctcatcttaaaactatattagcgacaggagaacttggaactcttact
aatgtctataaagccagtatgatagcaatgatggcaggatcagattttattaagacctct
actggaaaagaaacagtaaatgccaccttcccggtagctatagtaatgctgcgggccatt
agagatttcttctggaaaactggaaacaagatagggtttaaaccagcaggaggcatccgc
agtgcaaaggattcccttgcttggctctctcttgtaaaggaggagcttggagatgagtgg
ctgaagccagaactctttcgaataggtgccagtactctgctctcggacattgagaggcag
atttaccatcatgtgactggaagatatgcagcttatcatgatcttccaatgtcttaa

DBGET integrated database retrieval system