KEGG   Homo sapiens (human): 51075Help
Entry
51075             CDS       T01001                                 

Gene name
TMX2, CGI-31, PDIA12, PIG26, TXNDC14
Definition
(RefSeq) thioredoxin related transmembrane protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin
Motif
Other DBs
NCBI-GeneID: 51075
NCBI-ProteinID: NP_057043
OMIM: 616715
HGNC: 30739
Ensembl: ENSG00000213593
Vega: OTTHUMG00000167200
Pharos: Q9Y320(Tdark)
UniProt: Q9Y320
Structure
PDB: 

Position
11q12.1
AA seq 296 aa AA seqDB search
MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCD
FDWREVEILMFLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLC
IVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADL
SLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGR
AVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcttggcacctctaattgctctcgtgtattcggtgccgcgactttcacgatgg
ctcgcccaaccttactaccttctgtcggccctgctctctgctgccttcctactcgtgagg
aaactgccgccgctctgccacggtctgcccacccaacgcgaagacggtaacccgtgtgac
tttgactggagagaagtggagatcctgatgtttctcagtgccattgtgatgatgaagaac
cgcagatccatcactgtggagcaacatataggcaacattttcatgtttagtaaagtggcc
aacacaattcttttcttccgcttggatattcgcatgggcctactttacatcacactctgc
atagtgttcctgatgacgtgcaaaccccccctatatatgggccctgagtatatcaagtac
ttcaatgataaaaccattgatgaggaactagaacgggacaagagggtcacttggattgtg
gagttctttgccaattggtctaatgactgccaatcatttgcccctatctatgctgacctc
tcccttaaatacaactgtacagggctaaattttgggaaggtggatgttggacgctatact
gatgttagtacgcggtacaaagtgagcacatcacccctcaccaagcaactccctaccctg
atcctgttccaaggtggcaaggaggcaatgcggcggccacagattgacaagaaaggacgg
gctgtctcatggaccttctctgaggagaatgtgatccgagaatttaacttaaatgagcta
taccagcgggccaagaaactatcaaaggctggagacaatatccctgaggagcagcctgtg
gcttcaacccccaccacagtgtcagatggggaaaacaagaaggataaataa

DBGET integrated database retrieval system