KEGG   Homo sapiens (human): 51076
Entry
51076             CDS       T01001                                 

Gene name
CUTC, CGI-32
Definition
(RefSeq) cutC copper transporter
  KO
K06201  copper homeostasis protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    51076 (CUTC)
SSDB
Motif
Pfam: CutC
Other DBs
NCBI-GeneID: 51076
NCBI-ProteinID: NP_057044
OMIM: 610101
HGNC: 24271
Ensembl: ENSG00000119929
Vega: OTTHUMG00000018889
Pharos: Q9NTM9(Tbio)
UniProt: Q9NTM9
Structure
PDB: 
3IWP

Position
10q24.2
AA seq 273 aa
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGT
TPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSGMKFRNSSV
AMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaaaaggcagggggcctcctctgagcgaaaacgagcgcggataccgtccgggaaggcc
ggagcagcaaatggatttctcatggaagtttgtgttgattcagtggaatcagctgtgaat
gcagaaagaggaggtgctgatcggattgaattatgttctggtttatcagaggggggaact
acacccagcatgggtgtccttcaagtagtgaagcagagtgttcagatcccagtttttgtg
atgattcggccacggggaggtgattttttgtattcagatcgtgaaattgaggtgatgaag
gctgacattcgtcttgccaagctttatggtgctgatggtttggtttttggggcattgact
gaagatggacacattgacaaagagctgtgtatgtcccttatggctatttgccgccctctg
ccagtcactttccaccgagcctttgacatggttcatgatccaatggcagctctggagacc
ctcttaaccttgggatttgaacgcgtgttgaccagtggatgtgacagttcagcattagaa
gggctacccctaataaagcgactcattgagcaggcaaaaggcaggattgtggtaatgcca
ggaggtggtataacagacagaaatctacaaaggatccttgagggttcaggtgctacagaa
ttccactgttctgctcggtctactagagactcgggaatgaagtttcgaaattcatctgtt
gccatgggagcctcactttcttgctcagaatattccctaaaggtaacagatgtgaccaaa
gtaaggactttgaatgctatcgcaaagaacatcctggtgtag

DBGET integrated database retrieval system