KEGG   Homo sapiens (human): 51079Help
Entry
51079             CDS       T01001                                 

Gene name
NDUFA13, B16.6, CDA016, CGI-39, GRIM-19, GRIM19
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    51079 (NDUFA13)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    51079 (NDUFA13)
  Environmental adaptation
   04714 Thermogenesis
    51079 (NDUFA13)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    51079 (NDUFA13)
   05012 Parkinson's disease
    51079 (NDUFA13)
   05016 Huntington's disease
    51079 (NDUFA13)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51079 (NDUFA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIM-19 COX14
Motif
Other DBs
NCBI-GeneID: 51079
NCBI-ProteinID: NP_057049
OMIM: 609435
HGNC: 17194
Ensembl: ENSG00000186010
Vega: OTTHUMG00000162211
Pharos: Q9P0J0(Tclin)
UniProt: Q9P0J0
Structure
PDB: 

Position
19p13.11
AA seq 144 aa AA seqDB search
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL
QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL
IGELYGLRTTEEALHASHGFMWYT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgac
tacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggatt
ggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgccta
caaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgac
cggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac
gtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttg
atcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttc
atgtggtacacgtag

DBGET integrated database retrieval system