KEGG   Homo sapiens (human): 51082Help
Entry
51082             CDS       T01001                                 

Gene name
POLR1D, AC19, POLR1C, RPA16, RPA9, RPAC2, RPC16, RPO1-3, TCS2
Definition
(RefSeq) RNA polymerase I and III subunit D
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05169  Epstein-Barr virus infection
Module
hsa_M00181  RNA polymerase III, eukaryotes
hsa_M00182  RNA polymerase I, eukaryotes
Disease
H00610  Treacher Collins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    51082 (POLR1D)
   00240 Pyrimidine metabolism
    51082 (POLR1D)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    51082 (POLR1D)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    51082 (POLR1D)
 09160 Human Diseases
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    51082 (POLR1D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51082 (POLR1D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     51082 (POLR1D)
  RNA polymerase I system
   RNA polymerase I
     51082 (POLR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 51082
NCBI-ProteinID: NP_057056
OMIM: 613715
HGNC: 20422
Ensembl: ENSG00000186184
Vega: OTTHUMG00000016635
Pharos: Q9Y2S0(Tbio)
UniProt: P0DPB6
Position
13q12.2
AA seq 133 aa AA seqDB search
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKD
YKDQKASRNESTF
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggatcaggagctggagagaaaaatatctggattgaagacctcaatggctgaa
ggcgagaggaagacagccctggaaatggtccaggcagctggaacagatagacactgtgtg
acatttgtattgcacgaggaagaccataccctaggaaattctctacgttacatgatcatg
aagaacccggaagtggaattttgtggttacactacgacccatccttcagagagcaaaatt
aatttacgcattcagactcgaggtacccttccagctgttgagccatttcagagaggcctg
aatgagctcatgaatgtctgccaacatgtgcttgacaagtttgaggccagcataaaggac
tataaggatcaaaaagcaagcagaaatgaatccacattctag

DBGET integrated database retrieval system