KEGG   Homo sapiens (human): 51091Help
Entry
51091             CDS       T01001                                 

Gene name
SEPSECS, LP, PCH2D, SLA, SLA/LP
Definition
(RefSeq) Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
  KO
K03341  O-phospho-L-seryl-tRNASec:L-selenocysteinyl-tRNA synthase [EC:2.9.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    51091 (SEPSECS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    51091 (SEPSECS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.2  O-phospho-L-seryl-tRNASec:L-selenocysteinyl-tRNA synthase
     51091 (SEPSECS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 51091
NCBI-ProteinID: NP_058651
OMIM: 613009
HGNC: 30605
Ensembl: ENSG00000109618
Vega: OTTHUMG00000128563
Pharos: Q9HD40(Tbio)
UniProt: Q9HD40
Structure
PDB: 

Position
4p15.2
AA seq 501 aa AA seqDB search
MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTLELFLHELAI
MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGSSLLNKITNS
LVLDIIKLAGVHTVANCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMI
TAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPDRLEELAV
ICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFND
SFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYN
ERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFR
GFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVD
IEEMALKLDNVLLDTYQDASS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgagagcttcgcggcgggagagcggctggtgtcgccggcttacgtgcggcag
ggctgtgaggcccgccgctcgcatgagcacctcatacggctgcttctggagaagggcaag
tgtccagagaatggctgggatgaaagtacacttgaactctttttacatgaacttgcaatc
atggacagcaacaatttcttaggcaattgtggtgtgggagaaagggaagggagagtggca
tccgcactggttgctcgtcgtcattacaggttcattcatggcattggacgatccggtgat
atttctgctgtgcaaccaaaagctgcaggctctagccttttgaacaaaattaccaattct
ttggtcctggacattataaagctggctggtgtccatacagtagccaactgctttgtagtt
cctatggcaactggtatgagtctaactctgtgtttcttaacattacgacacaaaagacca
aaggcaaagtatattatatggccacgaatagaccagaagtcctgctttaaatccatgatc
actgcaggttttgagcctgtggtgatagaaaatgttttggaaggtgacgagctgcgtaca
gacctgaaagcagtggaggctaaagtccaggaacttgggcctgattgcattctgtgtatt
cattctactacatcctgttttgctccaagggtgcctgatagattagaagaactggctgtg
atttgtgctaattatgacattccacatatagttaataatgcttatggagtgcagtcttca
aagtgtatgcatctcattcagcagggggctcgagttggtagaatagatgcttttgttcag
agcttggacaaaaattttatggttccagtaggtggtgctataattgctggctttaatgat
tcattcattcaggaaatcagcaagatgtatccaggaagagcttcagcttcaccttcttta
gatgtccttattactttattgtcacttggatcaaatggctataagaagctactaaaagaa
agaaaggaaatgttttcatatttgtccaaccaaataaagaagttgtcagaagcctacaat
gaaagactgttgcatacacctcacaatcccatatctttagctatgacacttaaaacacta
gatgaacaccgtgacaaagctgtcactcagcttggctcgatgctttttaccagacaggtt
tctggagccagggttgtgcctcttgggtccatgcaaactgtgagtggctatactttcaga
ggctttatgtcacatacaaataattacccttgtgcttacctcaatgctgcatcagccatc
ggaatgaagatgcaggatgtggacctgttcataaagagacttgacaggtgtttaaaggca
gtaagaaaagaacgaagtaaagagagtgatgacaattatgacaaaactgaagatgtggat
attgaagaaatggctttaaaactagataatgtacttcttgacacataccaggatgcttct
tcatga

DBGET integrated database retrieval system