KEGG   Homo sapiens (human): 51094
Entry
51094             CDS       T01001                                 
Symbol
ADIPOR1, ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A
Name
(RefSeq) adiponectin receptor 1
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    51094 (ADIPOR1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    51094 (ADIPOR1)
  09149 Aging
   04211 Longevity regulating pathway
    51094 (ADIPOR1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    51094 (ADIPOR1)
   04932 Non-alcoholic fatty liver disease
    51094 (ADIPOR1)
SSDB
Motif
Pfam: HlyIII DUF4405 Mpo1-like
Other DBs
NCBI-GeneID: 51094
NCBI-ProteinID: NP_001277482
OMIM: 607945
HGNC: 24040
Ensembl: ENSG00000159346
Pharos: Q96A54(Tbio)
UniProt: Q96A54
Structure
Position
1:complement(202940825..202958572)
AA seq 375 aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgtggtggcacaggggaatggggctcctgccagtaacagg
gaagctgacacggtggaactggctgaactgggacccctgctagaagagaagggcaaacgg
gtaatcgccaacccacccaaagctgaagaagagcaaacatgcccagtgccccaggaagaa
gaggaggaggtgcgggtactgacacttcccctgcaagcccaccacgccatggagaagatg
gaagagtttgtgtacaaggtctgggagggacgttggagggtcatcccatatgatgtgctc
cctgactggctaaaggacaacgactatctgctacatggtcatagacctcccatgccctcc
tttcgggcttgcttcaagagcatcttccgcattcatacagaaactggcaacatctggacc
catctgcttggtttcgtgctgtttctctttttgggaatcttgaccatgctcagaccaaat
atgtacttcatggcccctctacaggagaaggtggtttttgggatgttctttttgggtgca
gtgctctgcctcagcttctcctggctctttcacaccgtctattgtcattcagagaaagtc
tctcggactttttccaaactggactattcagggattgctcttctaattatggggagcttt
gtcccctggctctattattccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatttctgccatcattgtggcgcagtgggaccggtttgccact
cctaagcaccggcagacaagagcaggcgtgttcctgggacttggcttgagtggcgtcgtg
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcactggagctggcctttatgctgctcga
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcagcctttgtccacttctatggagtctccaaccttcaggaa
ttccgttacggcctagaaggcggctgtactgatgacacccttctctga

DBGET integrated database retrieval system